(data stored in ACNUC7421 zone)

EMBL: CP001700.PE299

CP001700.PE299       Location/Qualifiers
FT   CDS_pept        339500..339703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0301"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR; KEGG: sgr:SGR_3882
FT                   MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69254"
FT                   /db_xref="GOA:C7QJB2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB2"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU69254.1"
FT                   /translation="MTARTPDAEPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTLGG
FT                   HRRYREQEVRALLNGIPPQREG"
     atgaccgcac gtacgccgga cgctgagcct ctgctcacgc ccgccgaggt cgccacgatg        60
     ttccgcgtcg accccaagac ggtcacgcgc tgggccaagg ccggcaagct gacctcgatc       120
     cgcaccctgg ggggtcaccg ccgctaccgc gagcaggagg tgcgcgctct gctgaacggc       180
     atcccgccgc agcgtgaggg ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page