(data stored in ACNUC7421 zone)

EMBL: CP001700.PE3

CP001700.PE3         Location/Qualifiers
FT   CDS_pept        4110..4988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: sco:SCO3877 6-phosphogluconate
FT                   dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68958"
FT                   /db_xref="GOA:C7QFL9"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL9"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACU68958.1"
FT                   /translation="MEIGLVGLGKMGGNMRERIRQAGHTVVGYDRDPKLADVGSLKELV
FT                   QTLAAPRVIWIMVPAGEATDATVNELADLLHTGDMVIDGGNSRWTEDIKHAELLKAQGV
FT                   AFVDAGVSGGVWGLQNGYALMVGGDEADIARVQPVFDALKPAGDSGFVHAGGVGAGHFS
FT                   KMVHNGIEYGIMQSYAEGWELLEAAPNVTNVREVFRSWQEGTVIRSWLLDLLVRALDDD
FT                   EHLAGIRGYADDSGEGRWTVEAGIDMAVPTPAITASLYARFTSRQEDSPQMKAIAALRN
FT                   QFGGHAVKKES"
     atggagatcg gtcttgtggg cctgggcaag atgggcggca acatgcgcga gcgcatccgc        60
     caggccgggc acaccgtcgt cgggtacgac cgcgacccca agctggccga cgtcggttcg       120
     ctgaaggagc tcgtccagac gctggcggcg ccgcgcgtga tctggatcat ggtccccgcc       180
     ggcgaggcca ccgacgccac ggtcaacgag ctggccgatc tgctgcacac cggcgacatg       240
     gtcatcgacg gcggcaactc gcgctggacc gaggacatca agcacgccga actcctcaag       300
     gcccagggtg tcgccttcgt cgacgccggc gtctcgggcg gcgtctgggg cctgcagaac       360
     ggctacgccc tgatggtcgg cggcgacgag gccgacatcg cccgcgtgca gccggtcttc       420
     gacgccctca agccggccgg cgacagcggc ttcgtgcacg ccggcggggt cggcgcgggc       480
     cacttctcga agatggtcca caacggcatc gagtacggca tcatgcagtc ctacgccgag       540
     ggctgggagc tgctggaggc cgctccgaac gtgaccaacg tgcgcgaggt cttccgctcc       600
     tggcaggagg gcaccgtcat ccgctcctgg ctgctggacc tgctggtccg cgccctggac       660
     gacgacgagc acctggcggg catccgcggc tacgccgacg actccggcga gggccgctgg       720
     accgtggagg ccggtatcga catggccgtg ccgaccccgg cgatcaccgc ctcgctgtac       780
     gcgcgcttca cctcgcgcca ggaggactcc ccgcagatga aggcgatcgc cgcgctgcgc       840
     aaccagttcg gcggccacgc cgtgaagaag gagagttag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page