(data stored in ACNUC7421 zone)

EMBL: CP001700.PE30

CP001700.PE30        Location/Qualifiers
FT   CDS_pept        30098..30643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0030"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: fre:Franean1_0089
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68985"
FT                   /db_xref="GOA:C7QFP6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP6"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU68985.1"
FT                   /translation="MRPEDEDEFRRFTAARWPGLVRTAYLLTGDLGHAEDLAQTTLIKA
FT                   YRSWHRVCRVEDVDAYVRKILINANRSRFRSKRPLEYSVAAVPEYPAWPPDDGSGVEER
FT                   TVLFAALATLPPRQRAIVVLRYWEDLAEGEVAALVGCSVGTVKSQASRALAKLRKDARL
FT                   AGLSAFQEPAAAMKGAQT"
     atgcgtcccg aggacgaaga cgagttccgc cgcttcacgg ccgcgcgctg gccggggctg        60
     gtgcggacgg cgtatctgtt gacgggggac ctcggtcacg ctgaggactt ggcgcagacc       120
     acgctgatca aggcgtatcg ctcgtggcat cgcgtgtgcc gggtcgagga tgtcgacgcc       180
     tacgtccgca agatcctgat caacgccaac cgcagccggt tccgctcgaa gcggccgctg       240
     gagtacagcg tcgccgccgt gcccgagtac cctgcctggc cgccggacga cggttccggc       300
     gtcgaggaac ggaccgtgtt gttcgccgcg ctcgccacgc tgccgccgag acagcgcgcg       360
     atcgtggtgc tgcggtactg ggaggacttg gcggaaggcg aggtcgccgc cctggtcggg       420
     tgctctgtag ggacggtcaa gagccaggcc tcgcgagcgt tggcgaagtt gcggaaggac       480
     gcgcgcctcg cggggctctc cgcgtttcag gagcccgcgg cggcgatgaa gggagcacag       540
     acatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page