(data stored in ACNUC7421 zone)

EMBL: CP001700.PE300

CP001700.PE300       Location/Qualifiers
FT   CDS_pept        complement(340009..341532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0302"
FT                   /product="Lysozyme"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: fre:Franean1_6988 lysozyme; PFAM:
FT                   cellulose-binding family II; SMART: cellulose-binding
FT                   family II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69255"
FT                   /db_xref="GOA:C7QJB3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB3"
FT                   /inference="protein motif:PRIAM:3.2.1.17"
FT                   /protein_id="ACU69255.1"
FT                   /translation="MGLSKRARVIGISLATAAVVGAGAVAAFSAGAAGSSSGSVTAAFA
FT                   KTSDWGTGFQGQYTIANSTGQTVHGWTVSFDLPSGERISSLWNGTMTAAGQHITVANPT
FT                   WAGDIATGTSATFGFVVDATSGSTAPQNCLVNGASCDGGTPGGGQSSAPGGAPSTAPGS
FT                   SSAPSSAPSSAPSSVPSSAPSSAPSSAPSSVPPPPASSGSYSFAPYVDTSQRQDLGAIA
FT                   TAAGAKDVTAAFMLAGGSGCTPAWNGSADAGFEGALKAGVADLRAKGGDVIASFGGANG
FT                   TELAGACKDVPSLKAAYKSVIDAYNLTHVDFDIEGAATTDQASITRRAQALAQLQADYA
FT                   AAGKTLDVSLTLPVLPSGLTQDGVNIVTAAATNNLKISVVNVMAMDFGDWAAPSPSGKM
FT                   GQYADQSAQSVHDQLKSVYPGATDAQLWSMVGITPMIGVNDTSDEVFQVSDASVVEQFA
FT                   AQHHIGRLAMWSLTRDQACAQPSSWASPTCSSIQQNTYDFAHTFEAFTG"
     atgggactgt cgaagcgcgc ccgcgtcata gggatctcac tcgccaccgc tgccgtcgtc        60
     ggcgccgggg ccgtcgccgc cttctcggcc ggcgccgccg gaagcagcag tggcagcgtc       120
     acggccgcct tcgccaaaac gtccgactgg ggtaccggct tccagggcca gtacacgatc       180
     gccaacagca ccggccagac cgtgcacggc tggaccgtct ccttcgacct gccgtccggg       240
     gagcgcatca gctccctgtg gaacggcacc atgaccgccg ccgggcagca catcacggtc       300
     gccaatccga cctgggccgg cgacatagcc accgggacca gcgcgacgtt cggcttcgtg       360
     gtggacgcca cctccgggtc caccgcgccg cagaattgcc tggtcaacgg agcgtcctgc       420
     gacggcggga cgcccggcgg cggtcagagc tcggcgcccg gcggcgcccc gagcacggca       480
     ccgggttcca gctcggctcc cagcagcgct ccgtcgagcg cgccgagcag cgtcccgtcc       540
     tcggcaccga gcagcgcgcc gtcctcggct ccctcctcgg tgccgccgcc gcccgcctcc       600
     agcggctcct acagcttcgc gccctacgtg gacaccagcc agcgccaaga cctcggcgcg       660
     atcgcgacgg cggccggggc gaaggacgtg accgcggcgt tcatgctcgc cggcggcagc       720
     ggctgcaccc cggcgtggaa cggctcggcc gacgccggct tcgaaggcgc cctgaaggcg       780
     ggcgtcgccg acctgcgcgc caagggcggc gacgtcatcg cctccttcgg cggcgccaac       840
     ggcaccgagc tggccggcgc ctgcaaggac gtgccgagcc tgaaggccgc ctacaagtcg       900
     gtgatcgacg cctacaacct gacccacgtg gacttcgaca tcgagggcgc ggccaccacc       960
     gatcaggcct cgatcacccg ccgggcccag gcgttggcgc agctgcaggc ggactacgcc      1020
     gccgccggca agaccctgga cgtgtcgctg accctgccgg tcctgccctc cgggctgacc      1080
     caggacgggg tgaacatcgt caccgcggcg gccacgaaca acctgaagat ctcggtcgtg      1140
     aacgtgatgg ccatggactt cggcgactgg gccgccccga gcccgtccgg gaagatgggc      1200
     cagtacgccg accagtccgc gcagtccgtg cacgaccagc tcaagagcgt ctaccccggc      1260
     gcgaccgacg cccagctgtg gtcgatggtc gggatcaccc cgatgatcgg cgtcaacgac      1320
     acctccgacg aggtgttcca ggtctccgac gcctcggtcg tggaacagtt cgccgcgcag      1380
     caccacatcg gccggctggc catgtggtcc ctgacgcggg accaggcgtg tgcgcagccg      1440
     tcgtcgtggg cttcccccac ctgctcctcg atccagcaga acacgtacga cttcgcgcac      1500
     accttcgagg ccttcacggg ctga                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page