(data stored in ACNUC7421 zone)

EMBL: CP001700.PE301

CP001700.PE301       Location/Qualifiers
FT   CDS_pept        complement(341687..342703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0303"
FT                   /product="cytochrome bd ubiquinol oxidase subunit II"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit II;
FT                   KEGG: fre:Franean1_6579 cytochrome d ubiquinol oxidase
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69256"
FT                   /db_xref="GOA:C7QJB4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB4"
FT                   /inference="protein motif:PFAM:PF02322"
FT                   /protein_id="ACU69256.1"
FT                   /translation="MTAVDLLLGVIVCALAAYALLAGADFGAGVWDLLARGRHADRERR
FT                   LIAHALGPVWEANHVWLIFVIVATFSGFPTAFGIIARGLELPLALALAGIVLRGAAYVY
FT                   RAYGEGAAGPDSLWSRVFAVASSITPFMLGVSGAALATGKITATSGPLTPFDSPFTLVA
FT                   GVFAVVVTAFLAAVYLCHDAGTDPETEDLVPAFRRRALGAAAVAGVVSMALLPLLYQDA
FT                   PIVAHRFTERSIPFVAVAVVCGFGSLAVIWKRHYVLARATAATAVIGVLLGWAAAQYPD
FT                   LAVGAATARGSAAGPANLHALLIAMGFGMVVILPAFYLLLKVFSGPEGAAGGSGLAN"
     atgaccgccg tcgacctcct cctgggcgtg atcgtctgcg ccctggccgc ctacgccctg        60
     ctcgccggcg ccgacttcgg cgccggggtc tgggatctgc tggctcgcgg ccgccacgcc       120
     gaccgcgagc gccgcctcat cgcccatgcg ctcggcccgg tctgggaggc gaaccacgtc       180
     tggctgatct tcgtgatcgt cgcgaccttc agcggcttcc cgaccgcctt cggcatcatc       240
     gcgcgcggct tggaactgcc gctggccttg gcgctggccg gcatcgtgct gcgcggggcg       300
     gcgtacgtct accgcgccta cggcgagggc gccgccgggc ccgacagcct gtggagccgg       360
     gtcttcgcgg tggcctcctc gatcaccccg ttcatgctcg gcgtcagcgg cgcggcgctg       420
     gcgaccggca agatcaccgc cacctccggt ccgctgaccc cgttcgactc ccccttcacg       480
     ctggtggccg gcgtcttcgc ggtcgtggtg accgcgttcc tggccgccgt ctacctctgc       540
     cacgacgccg gcactgaccc ggagaccgag gacctggtcc cggccttccg gcgcagggcg       600
     ctcggcgcgg cggcggtggc cggggtcgtc agcatggccc tgctgccgct gctgtatcag       660
     gacgcgccga tcgtcgcgca ccgcttcacc gagcgctcga tccccttcgt ggccgtcgca       720
     gtggtctgcg gattcggctc cctcgcggtg atctggaagc ggcactacgt cctggcccgc       780
     gcgacggccg ccacggcggt gatcggcgtg ctgctcggct gggccgcggc tcagtacccg       840
     gatctggcgg tcggggcggc gacggcccgc ggctcggcgg ccggaccggc gaacctgcac       900
     gccctgctga tcgcgatggg cttcgggatg gtggtcatcc tgcccgcgtt ttacctgctg       960
     ttgaaggtct tctcagggcc cgaaggcgcg gccggcggta gtgggctcgc aaactga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page