(data stored in ACNUC7421 zone)

EMBL: CP001700.PE302

CP001700.PE302       Location/Qualifiers
FT   CDS_pept        complement(342700..344181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0304"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: fre:Franean1_6580 cytochrome bd ubiquinol oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69257"
FT                   /db_xref="GOA:C7QJB5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB5"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACU69257.1"
FT                   /translation="MLGSSLSDARIETGFSLAFHIVFAVFGVGLPWLLLVTEGRWLKTR
FT                   DPVWLALTRKWSRVMAVLFAIGAVSGTVLSFEFGLLWPAFMARYGGVLGLPFTLEAFAF
FT                   FAEAIFVGLYLYGWKRLSPRAHWLTLWPIAISGTLSTLFIVTANSWMNVPTGVKEVGGK
FT                   VVSAEPLAPLTGPGALPESLHMLLAAIMCTGGVVAAVYAVGMLRGRRDSYHRRGFRVGL
FT                   VTVLAAAPLQLVVGDLAARVVEKYQPAKLAAMEALTHTQSHAPLTLGGIYDPSTGKTRF
FT                   GIEIPDGLSLLTGFRTDKTIRGLDILPAKQQPATPVVHLAFDTMVGGGMAILGLAGLLA
FT                   VVALWRRRKGVRPLIPLTRPWLLAGALTGPAAMAAMLAGWEVTEAGRQPWIVYGRMTVR
FT                   QAATTSGGIGWSLIATIAVYLGLATALLLILRRLATGAPPELAEGAEPSGPQDPESPTH
FT                   EPSGSEGDAEDSPESTETNAESTPESSPELEGAAR"
     atgctcggca gcagtctcag cgacgcccgc atcgagaccg ggttctcgct cgccttccac        60
     atcgtcttcg ccgtcttcgg ggtcgggctg ccctggctcc tgctggtcac cgagggccgc       120
     tggctgaaga cccgcgatcc ggtgtggctc gccctgaccc gcaagtggtc gcgggtgatg       180
     gcggtgctgt tcgccatcgg cgcggtgtcc gggaccgtcc tgtccttcga gttcgggctg       240
     ctgtggccgg cgttcatggc gcgctacggc ggggtgctcg ggctgccctt cacgctggag       300
     gccttcgcct tcttcgccga ggcgatcttc gtcggcctct acctctacgg ctggaagcgc       360
     ctgtcgccgc gtgcgcactg gctcacgctc tggccgatcg ccatctccgg cacgctctcg       420
     acgttgttca tcgtcaccgc gaactcctgg atgaacgtcc cgaccggcgt caaggaggtc       480
     ggcggcaagg tcgtctccgc cgaaccgctg gcgccgctca ccggcccggg cgcgctgccg       540
     gagtcgctgc acatgctgct cgccgcgatc atgtgcaccg gcggcgtggt cgccgcggtc       600
     tacgcggtcg ggatgctgcg cgggcggcgc gactcctatc accggcgcgg cttccgtgtc       660
     gggctggtca cggtcctggc ggcggcgccg ctccagctgg tggtcggcga cctggccgcg       720
     cgcgtggtcg agaagtacca gcccgcgaag ctcgccgcga tggaagccct gacccacacc       780
     cagagccacg ccccgctgac cctcggcggg atctacgacc cgagcaccgg caagacccgc       840
     ttcggcatcg agatcccgga cgggctgtcc ctgctgaccg gcttccggac cgacaagacc       900
     atccggggtc tggacatcct gcccgccaag cagcagcccg cgacgccggt ggtgcacctg       960
     gccttcgaca cgatggtcgg cggcggcatg gcgatcctcg gcctcgccgg gctgctcgcc      1020
     gtggtcgcgc tctggcgccg ccgcaagggt gtccgtcccc tgatcccgct gacccggccc      1080
     tggctgctgg ccggcgcgct gaccggcccg gcggcgatgg ccgcgatgct ggccggctgg      1140
     gaggtcaccg aggccgggcg ccagccgtgg atcgtctacg gccggatgac cgtgcgccag      1200
     gcggcgacca ccagcggcgg catcggctgg tcgctgatcg ccacgatcgc ggtctacctg      1260
     ggactggcca cggcgctgct gctgatcctg cgccggctgg cgaccggcgc cccgccggag      1320
     ctggcggaag gcgccgagcc gtcgggtccg caagaccctg agtcccccac gcacgagcct      1380
     tcgggctctg agggcgatgc ggaagacagc cccgagagca ctgagaccaa cgccgaaagc      1440
     acccccgaaa gcagccccga actggaagga gcagcccgat ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page