(data stored in ACNUC7421 zone)

EMBL: CP001700.PE304

CP001700.PE304       Location/Qualifiers
FT   CDS_pept        345021..345965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0306"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: aau:AAur_1766 M48
FT                   family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69259"
FT                   /db_xref="GOA:C7QJB7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB7"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU69259.1"
FT                   /translation="MFADAWPLAVLAILLAWPVPVFLARAAWPRRHARAAIALWQAVGV
FT                   AGGLALIGAPLAVGVAPLDGHLRTGLVELWRDAFHLRVPAALGLAQEIALALAAVLTVR
FT                   LVGVTLLSAWRIERDLRRQRDAVDLAAEHADRDLRVLEHAAPAAYCLPGTRPRIVITEG
FT                   TIAALAPDELEAVLAHERAHARWRHELVVQPFVAWESALPLPPARRATASVTALVEMLA
FT                   DDHAARSVGRPALARALVAIGGTAGPVPNQRTDGAPGSGSDPNPVRATPTLDRVQRLVR
FT                   RPKATSLAERLIGPAAWLAAVLLVAGPTWYVLR"
     gtgttcgctg acgcctggcc gctggccgtc ctcgcgatcc tgctcgcctg gccggtcccg        60
     gtgttcctgg cccgcgccgc ttggccgcgg cggcatgcgc gcgccgccat cgcgttgtgg       120
     caggcggtcg gcgtcgccgg tggtctggcg ctgatcgggg cgccgttggc ggtgggcgtc       180
     gccccgctcg acggtcatct gcgcaccggg ctggtcgagc tgtggcgcga cgccttccat       240
     ctgcgcgtgc ccgcggcgct cggtctggcc caggagatcg cgctggcgct cgccgccgtg       300
     ctgacggtcc ggctggtcgg tgtgaccttg ctctcggcgt ggcggataga gcgcgatctg       360
     cggcgccagc gcgacgccgt cgacctcgcc gccgagcacg ccgaccggga tctgcgcgtc       420
     ctggaacacg ccgcgcccgc cgcctactgc ctgcccggca cgcggccgcg catcgtcatc       480
     accgagggca ccatcgccgc actcgccccc gacgagctcg aagcggtcct cgcccacgag       540
     cgcgcccacg cccggtggcg ccacgagctc gtggtccagc ccttcgtcgc ctgggagtcg       600
     gcgctgccgc tgcctccggc ccggcgcgcg accgcctcgg tcaccgccct cgtcgagatg       660
     ctcgccgacg accacgccgc ccgctccgtc ggacgtccgg cactggcccg cgcgctcgtc       720
     gctatcggcg gcaccgccgg tccggtaccg aatcagcgca cggacggcgc cccgggttcc       780
     ggctccgatc ccaaccccgt ccgcgccacg ccgaccctcg accgcgtcca gcgcctggtc       840
     cgccggccca aggcgaccag cctcgccgaa cgcctcatcg gcccggcggc ctggctcgcc       900
     gcggtgctgc tcgtcgccgg gccgacctgg tacgtcctgc gctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page