(data stored in ACNUC7421 zone)

EMBL: CP001700.PE305

CP001700.PE305       Location/Qualifiers
FT   CDS_pept        complement(346002..347297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0307"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.21"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   sgr:SGR_3783 putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69260"
FT                   /db_xref="GOA:C7QJB8"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB8"
FT                   /inference="protein motif:PRIAM:3.4.11.21"
FT                   /protein_id="ACU69260.1"
FT                   /translation="MPIFDRAHTDDLLAFLAASPTPYHAVTNAAARLEAAGFRQLRQSA
FT                   GWESADGGGFYAIRGAAIIAWYLPEGAAAPTGFRVVGAHTDSPNLRVKPLPDTGSAGFR
FT                   QVAVELYGGPLLNSWLDRDLGLAGRLVLRGGEAALVHVDRALMRVPQLAVHLDRGVNDS
FT                   GLLLDKQQHLTPAWGLGPVEDGALIEFAAKEAGVSASDVMGFDLMLHDVTPPTYLGRDQ
FT                   EMIAAPRMDNLVSVHAGVQALIAAASGAGGPLTAIPVLAAFDHEETGSESDTGAGGPLL
FT                   GTILSRVTQAQLGGSADDYARALAATVVMSSDMSHAVHPNYPERHEPGHRPRLNGGPAL
FT                   KTNVNQRYATDGLGRAIWTDVCERAGIPTQYFVGKNSLPCGTTIGPITAAKLGVTTFDV
FT                   GITSLSMHSAREMGGADDPFLLASAAASFFAG"
     atgccgatat tcgatcgcgc ccacacggac gacctcctcg ccttcctcgc cgcctcgccg        60
     accccgtacc acgcggtcac gaacgcggcc gcccgcctcg aggccgccgg gttccgccag       120
     ctcaggcaat ccgccgggtg ggagagcgcc gacggcggcg ggttctacgc catccgcggc       180
     gcggcgatca tcgcctggta cctgcccgag ggcgcggcgg cgccgaccgg gttccgggtc       240
     gtcggcgccc acaccgactc ccccaacctg cgggtcaagc cgctgccgga caccggctcg       300
     gcgggcttcc ggcaggtggc ggtcgagctg tacggcgggc cgctgctgaa ctcctggctg       360
     gaccgcgacc tgggcctggc cgggcggctg gtgctgcgcg gcggcgaggc ggcgctggtg       420
     cacgtcgacc gcgcgctgat gcgcgtgccg cagctggccg tccacctgga ccgcggcgtg       480
     aacgacagcg ggctgctgct ggacaagcag cagcacctga ccccggcgtg gggtctgggc       540
     ccggtcgagg acggcgcgct gatcgagttc gcggcgaagg aggcgggcgt ctcggcctcc       600
     gacgtcatgg gcttcgacct gatgctgcac gacgtgaccc cgccgaccta cctgggccgc       660
     gaccaggaga tgatcgccgc cccgcggatg gacaacctgg tctcggtgca cgccggggta       720
     caggcgctga tcgcggcggc ttccggcgcc ggcggaccgc tgacggcgat cccggtgctc       780
     gccgcgttcg accacgagga gaccggcagc gagtcggaca ccggcgcggg cgggccgctg       840
     ctcggcacca tcctgagccg cgtgacccag gcgcagctcg gcgggagcgc ggacgactac       900
     gcgcgggccc tggccgcgac cgtggtcatg tccagcgaca tgagccacgc ggtccacccg       960
     aactaccccg agcgccacga gcccggccac cgcccccggc tcaacggcgg cccggcgctg      1020
     aagacgaacg tcaaccagcg ctacgccacc gacgggctcg gccgcgcgat ctggaccgac      1080
     gtctgcgagc gcgcggggat cccgacgcag tacttcgtgg ggaagaactc gctgccgtgc      1140
     gggaccacga tcgggccgat caccgcggcg aagctcggcg tgacgacgtt cgacgtgggg      1200
     atcacgtcgc tgtcgatgca ctcggcgcgc gagatgggcg gggcggacga tccgttcctg      1260
     ctggcgtcgg cggcggcgag cttcttcgcc ggctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page