(data stored in ACNUC7421 zone)

EMBL: CP001700.PE306

CP001700.PE306       Location/Qualifiers
FT   CDS_pept        complement(347404..349626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0308"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: nca:Noca_3656 MmpL
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69261"
FT                   /db_xref="GOA:C7QJB9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB9"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACU69261.1"
FT                   /translation="MFGRLGRFVVHNPWKIIVGWIIAAVALVAFGPQLSSVTNDNQSSF
FT                   LPSKYESVQAKNALDAEFPSTVGQVATIVIRPVGDGALSAAEQQKVSDLATTLTGDHIT
FT                   GVAGVQAGQVSPKQTAQLMFAKLTADQGDQKASSDAVKALRADLAAKLNGSGMKAEVTG
FT                   DAAMGLDTSDSSNKATGIVMMATLLLIIVLMGFIFRGVIAVLLPILSVFLVMMVSQPVI
FT                   ALMAKGFGLHVQSFLEIMLVVVLFGIGTDYIVFLLFRLRERLRAGDTIQQAVATTVERV
FT                   GEAIASAAAAVIIAFCALGLATFKAFTSLGPALAIAVAVMLLAGLTLVPALMVTLGTKI
FT                   FWPGKKWRRVPTAGPARKVGNLVGKRPAAVAAVSFVIMAGLAVGAVGFKADYDQQSQMP
FT                   GGVESTIAIKDMQKAGFAQGATAATDVIVTSTDGKPLDQAKLQTYADGLGAASPELSGL
FT                   MPFPVKPGSPAGTKGATVEYNQAGTAAHIQVLTKDSPFAAAAMSAVDGPLKSAAHSTVP
FT                   AGAKALVGGGTAALSDIQAANNSDLALILPVAGLLIFLVLALQLRALVAPLYLMVAVGL
FT                   GYTGTLGASVLMFQTVQNKPGMMFMLPVMVYLFVVAIGTDYNILMISRLREEAREGHDP
FT                   RRAAALAVEHAGPSVASAGLILAGTFASLMLGGLAMMQQIGFAVSFGISIAAFVMSMFL
FT                   VPAVTALMGAKAWWPGHKGVASATAGVGRPVVSDLDDEVVGAGAHR"
     atgttcggac ggctcggacg cttcgtcgtc cacaatccct ggaagatcat tgtcggctgg        60
     atcatcgcgg ccgtggcgct cgtcgccttc ggcccgcagc tgtccagcgt caccaacgac       120
     aaccagtcct ccttcctgcc ctccaagtac gagtccgtcc aggccaagaa cgccctggac       180
     gcggagttcc cctccaccgt cgggcaggtc gcgaccatcg tgatccggcc ggtcggcgac       240
     ggcgcgctct ccgccgcgga gcagcagaag gtctctgacc tggccaccac cttgaccggc       300
     gaccacatca ccggggtcgc cggggtgcag gccggccagg tctcgccgaa gcagaccgcg       360
     cagctgatgt tcgccaagct gaccgccgac cagggcgacc agaaggcgag cagcgacgcc       420
     gtcaaggcac tgcgcgcgga cctggcggcc aagctgaacg gctccggcat gaaggccgag       480
     gtgaccggcg acgcggccat gggcctggac acctcggact cctcgaacaa ggccaccggc       540
     atcgtcatga tggccacgct gctgctgatc atcgtcctga tgggcttcat cttccggggc       600
     gtcatcgcgg tcctgctgcc gatcctgtcg gtgttcctgg tgatgatggt ctcccagccg       660
     gtcatcgcgc tgatggccaa ggggttcgga ctgcacgtgc agtccttcct ggagatcatg       720
     ctggtcgtgg tgctgttcgg catcgggacc gactacatcg tcttcctgct gttccggctg       780
     cgggaacggc tgcgggccgg ggacacgatc cagcaggcgg tggcgaccac cgtcgagcgc       840
     gtcggcgagg ccatagcctc ggccgcggcc gcggtcatca tcgccttctg cgccctggga       900
     ctggccacct tcaaggcctt cacctcgctg ggcccggcgc tggccatcgc ggtcgcggtg       960
     atgctgctgg ccggtctgac cctggtcccg gcgctgatgg tgacgctggg cacgaagatc      1020
     ttctggcccg gcaagaagtg gcgccgcgtc ccgaccgcgg gcccggcccg caaggtgggc      1080
     aacctggtcg gcaagcgccc ggccgcggtg gccgcggtct ccttcgtcat catggcgggg      1140
     ctggcggtcg gcgcggtcgg cttcaaggcg gactacgacc agcagtcgca gatgccggga      1200
     ggcgtcgagt ccacgatcgc tatcaaggac atgcagaagg ccggcttcgc ccagggcgcg      1260
     accgccgcga cggacgtgat cgtcacctct accgacggca agccgctgga ccaggccaag      1320
     ctccagacct acgccgacgg gctcggcgcg gcctcgccgg agctcagcgg cctgatgccg      1380
     ttcccggtca agccgggctc cccggccggc accaagggcg ccacggtcga gtacaaccag      1440
     gccggaaccg cggcgcacat ccaggtgctg accaaggatt cgccgttcgc cgcggccgcg      1500
     atgagcgcgg tcgacggccc gctgaagagc gccgcgcaca gcaccgtccc ggccggagcc      1560
     aaggcgctgg tcggcggcgg gaccgcggcg ctgtccgaca tccaggcggc gaacaactcc      1620
     gacctggcgc tgatcctgcc ggtcgccggg ctgctgatct tcctggtgct ggcgctgcag      1680
     ctgcgggccc tggtcgcgcc gctgtacctg atggtcgccg tgggtctggg ctacaccgga      1740
     accctgggcg cctcggtgct gatgttccag accgtccaga acaagcccgg catgatgttc      1800
     atgctgccgg tcatggtcta cctgttcgtg gtggcgatcg gcaccgacta caacatcctg      1860
     atgatctccc ggctccgcga ggaggcccgc gagggccacg acccgcggcg cgcggcggcg      1920
     ctggccgtcg agcacgccgg gccgtcggtc gcctcggccg ggctgatcct ggccggcacg      1980
     ttcgcctcgc tgatgctggg cgggctggcg atgatgcagc agatcgggtt cgcggtgtcg      2040
     ttcggcatca gcatcgcggc gttcgtgatg tcgatgttcc tggtgccggc cgtcacggcg      2100
     ctgatgggag ccaaggcgtg gtggcccggg cacaagggtg tggcgtccgc gaccgccggg      2160
     gttgggcggc cggtcgtcag cgacctggac gacgaggtcg tcggcgcagg tgcgcaccgg      2220
     tga                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page