(data stored in ACNUC7421 zone)

EMBL: CP001700.PE307

CP001700.PE307       Location/Qualifiers
FT   CDS_pept        349752..350393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0309"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_6185
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69262"
FT                   /db_xref="GOA:C7QJC0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69262.1"
FT                   /translation="MRRNSQSEHDPGGTKERIQHVALELFVLHGYEKTSLREISDRLGI
FT                   TKAALYYHYASKQELLKSVTQPLIDEFELLVAGDPDPETLLRSYVDLLHRHQAVFQLVA
FT                   NDHASLAAAELVERSVKLRRDVVRRLAGPEPQPADYIRAAAAFGAISQGFMLARRVEPA
FT                   ADPALPDVEATAEKAAETAAGLPAPADYPEGAELTRILMDTALAVLRSGS"
     atgagacgca actcacagtc ggagcacgac cccggcggta ccaaggaacg catccagcac        60
     gtcgcgctgg agctgttcgt cctgcacggg tatgagaaga cctcactgcg cgagatctcc       120
     gaccgcctcg gcatcaccaa ggccgcgctg tactaccact acgcgtccaa gcaggagctg       180
     ctgaagtcgg tcacccagcc gctgatcgac gagttcgaac tcctggtcgc cggcgatccg       240
     gatcccgaga cgctgctgcg ttcctacgtc gacctgctgc atcggcacca ggcggtcttc       300
     cagttggtcg ccaacgacca cgccagcctg gccgccgccg agctggtcga gcgctcggtg       360
     aagctgcggc gggacgtcgt gcgcaggctg gccggccccg agccgcagcc cgccgactac       420
     atccgcgccg cggctgcgtt cggagccata tcgcagggct tcatgctcgc gcggcgcgtc       480
     gagccggcgg ccgatccggc gctgccggac gtcgaggcga ccgcggagaa ggctgccgag       540
     acggctgccg gactaccggc tccggcggac taccccgagg gcgccgagct cacgcggatc       600
     ttgatggaca ccgcgctggc ggtgctgcgc tccgggtcct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page