(data stored in ACNUC7421 zone)

EMBL: CP001700.PE308

CP001700.PE308       Location/Qualifiers
FT   CDS_pept        350452..351315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0310"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: tfu:Tfu_2825 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69263"
FT                   /db_xref="GOA:C7QJC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACU69263.1"
FT                   /translation="MDLALLRTFLAVHRAGSLTRAAADLGVSQPAVTAQVRTLEQRVGR
FT                   ELFVRLPRGVAPTAAADELARAIAPHLDALAAVAHETLVPDSGPLAAVRLGCPASLTTT
FT                   LLLPALAPLVDEGLRVVVAGGRSDDLVAQLATGRLDLTLAVTRPRLPGVTVIPLADEEY
FT                   ALVGAPRWKPFDRTGRTPLLDLSENLPYISLYWSSVYDTRPTSDAALVIPDLRGVLDAA
FT                   VAGCGAAVLPLPLCAPALDDWTLVLLDEPEIPPIRTLFVAVRGQRARSAAVARVRDRLV
FT                   AVASRW"
     atggatctcg cgctgctgag gacgttcctc gccgtccacc gcgccggctc gctcacccgg        60
     gccgccgcgg atctcggcgt gtcccagccc gcggtgaccg cgcaggtcag gacgctggag       120
     caacgcgtcg gccgcgagct gttcgtccgg ctgccgcgcg gcgtcgcgcc cacggcggcc       180
     gccgacgagc tggcccgggc gatcgcgccg catctggacg cgctcgccgc ggtcgcgcac       240
     gagacgctgg tcccggattc cgggccgctc gccgcggtac gcctcggctg tccggctagt       300
     ctgaccacga cgctactgct tccggccctc gctcccttgg tggacgaggg ccttcgcgtg       360
     gtcgtggccg gcgggcgcag cgacgacctg gtcgcgcagc tggcgaccgg ccgcctggac       420
     ctgacgctcg cggtcaccag accgaggctg cccggagtga cggtgatccc gctcgccgac       480
     gaggagtacg cgctggtcgg ggcgccgcgc tggaagccct tcgaccgcac gggccgcacg       540
     ccgctgctcg acctctcgga gaatcttcct tatataagtc tctactggtc gtccgtatac       600
     gacacccgac ccacatccga cgccgcgctg gtcatccccg acctgcgcgg cgttctcgat       660
     gcggcggtcg ccggctgcgg cgcggcggtc ctgcccctgc cgctgtgcgc cccggcgctc       720
     gacgactgga cactggtcct gctcgacgag cccgagattc cgccgatccg gacgctgttc       780
     gtcgcggtgc gcgggcagcg ggcccggtcg gcggcggtgg cgcgggtccg ggaccggctg       840
     gtcgctgtcg cctcgcgctg gtag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page