(data stored in ACNUC7421 zone)

EMBL: CP001700.PE309

CP001700.PE309       Location/Qualifiers
FT   CDS_pept        351679..352761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0311"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   sgr:SGR_1348 putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69264"
FT                   /db_xref="GOA:C7QJC2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC2"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACU69264.1"
FT                   /translation="MTWELPAQGQAQEATQAIPAQNGSLNPDSLNPEVYASLFRPEGAP
FT                   ARANPNATQVMPSVPDDYGRPGYDQDGYPQAGYDQRAANQPAYDQPIDYQAAGGGAYAE
FT                   PYETGYADDYPDEPSARPSNRGTKIGIGVAAGAVLVIVISLITLGGGSSKPSAGPANTP
FT                   GTVTTPTVPPSTSAPQVAASDPATSTPSSPASSTSHAPGTLQLGDSGAEVKWLQTRLHQ
FT                   LGVYNGPINSKFDAATQAAVAAFQAKTHASDPAGVVGRSTKTALIAAGSKPTLMGQVPN
FT                   LPGGPLGGDKHHRGNNPADVKRLQQALAVALNTNLKATGQFDLDTFGAVVQYQGAMHMT
FT                   PDGLVNGTVWAALQQGRISG"
     atgacgtggg agctgccggc gcagggccag gcccaggaag cgacccaggc catcccggcg        60
     cagaacggtt cgctgaaccc tgattcgctg aaccctgagg tgtacgccag cctgttccgc       120
     cctgagggcg ctccggcgcg cgcgaacccg aacgccacgc aggtcatgcc gtcggtcccg       180
     gacgactacg gccggcccgg gtacgaccag gacggctatc cgcaggccgg atacgaccag       240
     cgtgctgcga accagcccgc ctacgaccag ccgatcgact accaggccgc gggcggcggc       300
     gcctacgccg agccttacga gaccggatac gccgacgact acccggacga gcccagcgcc       360
     cgtccgtcca atcgcgggac gaagatcggc atcggtgtcg cggccggcgc ggtgctggtg       420
     atcgtgatct cgctgatcac cctcggcggc ggcagctcga agccctccgc cggaccggcc       480
     aacacgccgg gcacggtcac cacgccgacc gtgccgccga gcacctccgc gccgcaggtc       540
     gcggccagcg acccggccac ctccacgccg agcagcccgg ccagctcgac gtcgcacgcc       600
     ccggggacgc tgcagctcgg cgactccggc gccgaagtga agtggctgca gacgcggctg       660
     caccagctgg gcgtctacaa cggcccgatc aacagcaagt tcgacgccgc cacgcaggcc       720
     gcggtcgccg cgttccaggc gaagacccac gcgagcgacc ccgcgggcgt cgtcggccgg       780
     tccaccaaga ccgcgctgat cgcggcgggg agcaagccga ccctgatggg gcaggtgccg       840
     aatctgcccg gcggtccgct cggcggggac aagcaccacc ggggcaacaa ccccgcggac       900
     gtgaagcggc tgcagcaggc gctggccgtc gcgctgaaca cgaacctgaa ggccaccggc       960
     cagttcgacc tggacacctt cggcgcggtg gtgcagtacc agggcgcgat gcacatgacg      1020
     ccggacgggc tggtcaacgg cacggtgtgg gcggcgctgc agcaggggcg gatctcgggc      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page