(data stored in ACNUC7421 zone)

EMBL: CP001700.PE31

CP001700.PE31        Location/Qualifiers
FT   CDS_pept        30640..31470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0031"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: sgr:SGR_5473 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68986"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP7"
FT                   /inference="similar to AA sequence:KEGG:SGR_5473"
FT                   /protein_id="ACU68986.1"
FT                   /translation="MTDEAWENGLREVMTGAAGSTRVAPPPTDAILRGGRSSLRLRNGL
FT                   TGSGVLGMVAAAVIVGTSFGGGATVGSVQQAGTTSTSAQPPQAQDAAVTLGPASAKTKV
FT                   VVYEDYRCPPCRDVEAGTSAYLTEEADSGKIQVEYRAVNLIDRNGQTSGSGSTAAGNAV
FT                   QCAADRGDFSAYRSAVYAHQPQENLDAFTSSALLITIARTIPGLDTAAFEKCVDDQPYA
FT                   AAISSNYTRAFTTAHCTGVPCISVDGQQWTGSIPEGADVGKIINAWLAQKISAA"
     atgacggacg aggcgtggga gaacggcctg cgtgaggtca tgaccggtgc cgcgggctcg        60
     acgcgggtcg cgccgccgcc gaccgacgcg atcctgcggg gcggtcggtc ctcgctccgg       120
     ctgcgcaacg gattgaccgg atcaggggtg ctcgggatgg tcgccgccgc ggtgatcgtg       180
     gggacgtcct tcggcggcgg tgcgactgtc ggttccgtcc agcaggccgg cacgacgtcc       240
     acctcggcgc agccgccgca ggcgcaggac gcggcggtca ccctcgggcc ggcgtcggcg       300
     aagacgaagg tggtcgtcta cgaggactac cgctgcccgc cgtgccggga cgtcgaggcc       360
     gggaccagcg cttacctgac cgaggaggct gattccggca agatccaggt cgaataccgc       420
     gcggtcaacc tcattgatag gaacggacag acgtcgggta gcgggtccac agcggcaggc       480
     aacgcagtgc aatgcgccgc cgaccgcggc gacttctccg cctaccggag cgcggtctac       540
     gcccaccagc ctcaagaaaa cctagacgcc ttcacgtcat cggcgctgct gatcacgatt       600
     gccaggacga tcccggggct ggacactgcg gcgttcgaga agtgtgtgga cgatcagccg       660
     tacgcggcgg cgataagcag caactacacc agagccttca ccacggcgca ctgcaccggc       720
     gtgccgtgta tcagcgtcga cggtcagcag tggacgggca gtatcccgga gggtgccgac       780
     gtgggaaaga tcatcaatgc ctggctcgcg caaaagatct cggccgccta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page