(data stored in ACNUC7421 zone)

EMBL: CP001700.PE310

CP001700.PE310       Location/Qualifiers
FT   CDS_pept        complement(352923..353228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_2449 TfoX C-domain superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69265"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69265.1"
FT                   /translation="MSSTETVTLIQNAVNIGPVLTQRLRDVGVTTLDEVRERGAIEVWQ
FT                   LIAHTAEGNECAHMLLALEGALRGQRWTSIPRSERDALLVEVGLKDASELRAPKKR"
     gtgagttcga ctgagacggt caccctgatc cagaacgccg tgaacatagg gccggtgttg        60
     acacaacggc tccgcgacgt cggcgtcacg accctggacg aggtccgtga gcgcggcgcc       120
     atcgaggtat ggcagctgat cgcccacacc gccgagggca acgagtgcgc gcacatgctg       180
     ctggcgctgg agggcgcgct gcgcggccag cggtggacct cgatcccgcg ctcggaacgc       240
     gacgcgctgc tggtcgaggt cgggctgaag gacgcctccg agctgcgggc gcccaaaaag       300
     cgctag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page