(data stored in ACNUC7421 zone)

EMBL: CP001700.PE311

CP001700.PE311       Location/Qualifiers
FT   CDS_pept        complement(353306..353719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0313"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="PFAM: Mov34/MPN/PAD-1 family protein; SMART:
FT                   Mov34/MPN/PAD-1 family protein; KEGG: tfu:Tfu_2370
FT                   Mov34/MPN/PAD-1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69266"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB0"
FT                   /inference="protein motif:PFAM:PF01398"
FT                   /protein_id="ACU69266.1"
FT                   /translation="MLTVSQEIYDAIVAHARRDHPDEACGIVAGPEGSDRPERFVPMAN
FT                   AERSPTFYRLDPAEQFKVWREMDDRDEEPVIVYHSHTSTEARPSRTDISYASEPNAHYV
FT                   LVSTRDTDKLGDFQFRSFRIVDGEVTEEPVTVL"
     atgctgaccg tctcgcagga gatctacgac gcgatcgtcg cgcacgcccg ccgggaccac        60
     cccgacgagg cctgcgggat cgtcgccggg ccggagggct ccgaccgccc cgagcgcttc       120
     gtgccgatgg ccaacgccga gcgctcgccg acgttctacc ggctggaccc ggccgagcag       180
     ttcaaggtgt ggcgggagat ggacgaccgc gacgaggagc cggtgatcgt ctaccactcg       240
     cacacctcga ccgaggctcg tccctcgcgg accgacatca gttatgcctc tgaacccaat       300
     gcgcattacg tgctggtgtc cacgcgcgac accgacaaac tcggcgactt ccagttccgc       360
     tcgttccgga tcgtcgacgg cgaggtgacc gaggagccgg tgacggtcct ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page