(data stored in ACNUC7421 zone)

EMBL: CP001700.PE312

CP001700.PE312       Location/Qualifiers
FT   CDS_pept        353797..355236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0314"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sgr:SGR_1900 putative glucose transporter;
FT                   TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69267"
FT                   /db_xref="GOA:C7PVB1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB1"
FT                   /inference="protein motif:TFAM:TIGR00879"
FT                   /protein_id="ACU69267.1"
FT                   /translation="MTTRTGRESGPNPPGDSAAARVAPRIVFIAAAAALGGFLFGYDSA
FT                   VINGAVTGIQHDFNVGSGTTGFVVAAALPGAAAGAIAGGWMADRIGRIRAMQIAAVLFI
FT                   ISGIGSMFAFQPWDLTIWRILGGFAIGIASVIGPAYIAEVSPPAFRGRLTSFQQLAIVL
FT                   GIAISALVNYLINQWAGGTNTDHLGGLAAWRWMLGAEVIPAILYGVLSTMIPESPRFLV
FT                   ANGEDDRAREVLAEVEGTHANVADRIAEIRDQLAGEVKPKLADLLTPSRKNLLAVVWIG
FT                   IGLSVLQQFVGINVIFYYSSLLWQSVGIDTSNSLLISMISAAVNIAGTVVAMALVDRIG
FT                   RRPLLLIGSVGMAVTLGLCAWMFSYGTHANGKTTLPKAQGVTALLGANAYVFFFAMSWG
FT                   VVVWVLLGEMFPNRIRAVALSVAASAQWLANWLVTVSFPSLSRWSLAGAYSLYAIAAAV
FT                   SIPFVYYLVRETKGKTLESMG"
     atgacgacca ggaccggccg cgagagcggt cccaacccgc cgggcgattc cgcggcggcc        60
     cgcgtcgcgc cgcgcatcgt gttcatcgct gccgccgcgg ccttgggcgg cttcctgttc       120
     ggctacgact ccgcggtgat caacggcgcg gtcaccggga tccagcacga cttcaacgtc       180
     ggcagcggga cgaccggctt cgtcgtcgcc gcggccctgc ccggcgccgc cgccggggcg       240
     atcgccggcg gctggatggc cgaccggatc ggccggatcc gcgccatgca gatcgcggcg       300
     gtcctgttca tcatcagcgg catcggcagc atgttcgcct tccagccctg ggacctgacg       360
     atctggcgca tcctcggcgg cttcgctatc ggcatcgcct cggtgatcgg cccggcctac       420
     atcgccgagg tctccccgcc ggccttccgc ggccggctga cctccttcca gcagctggcg       480
     atcgtgctgg gcatcgcgat ctccgcgctc gtcaactatc tgatcaacca gtgggccggc       540
     ggcaccaaca ctgaccacct cggcgggctg gccgcctggc gctggatgct cggcgccgag       600
     gtgatcccgg cgatcttgta cggcgtgctg agcacgatga tcccggagtc gccgcgcttc       660
     ctggtcgcga acggcgagga cgaccgggcc cgcgaggtgc tcgccgaggt cgagggcaca       720
     cacgcgaacg tcgccgaccg catcgccgag atccgcgatc agctggccgg ggaggtcaaa       780
     ccgaagctgg cggacctgct caccccgagc cggaagaacc tgctggcggt ggtctggatc       840
     ggcatcggac tctcggtgct gcaacagttc gtcggcatca acgtgatctt ctattacagc       900
     tccctgctgt ggcagtcggt cggcatcgac acctccaact cgctgctgat ctcgatgatc       960
     tccgcggcgg tgaacatcgc cggcaccgtg gtggcgatgg cgctggtgga ccggatcggc      1020
     cggcgtccgc tgctgctgat cggctcggtg gggatggcgg tgacgctggg gctgtgcgcc      1080
     tggatgttct cctacggcac gcacgccaac ggcaagacca ccctgccgaa ggcccagggc      1140
     gtcacggcgc tgctcggcgc gaacgcctac gtgttcttct tcgcgatgtc ctggggcgtc      1200
     gtggtctggg tgctgctcgg cgagatgttc ccgaaccgga tccgcgccgt ggcgctgtcg      1260
     gtcgcggcca gcgcgcagtg gctggcgaac tggttggtga cggtctcgtt cccgtcgctg      1320
     tcccgctgga gcctggccgg ggcgtactcg ctctacgcga tcgcggcggc ggtctccatc      1380
     cccttcgtgt actaccttgt ccgggaaacg aagggaaaaa ccttggaatc gatgggatag      1440
//

If you have problems or comments...

PBIL Back to PBIL home page