(data stored in ACNUC7421 zone)

EMBL: CP001700.PE313

CP001700.PE313       Location/Qualifiers
FT   CDS_pept        355276..355788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0315"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: stp:Strop_3309 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69268"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB2"
FT                   /inference="similar to AA sequence:KEGG:Strop_3309"
FT                   /protein_id="ACU69268.1"
FT                   /translation="MGLDFRTDPETLREIVDDPAALAARIHTLAALDMDEHPEARSEYA
FT                   TLLRIAGRLDDAALEAELTLAAADLAGDLRRMVRATLLVGHVRQYRGEWDQADTMFHRA
FT                   EKLALYLKDDRLVAAAAHHSGRSFYDQGKHVEAALRFRLALEIDTRIGSPKVSAVWEAF
FT                   EAAMAKL"
     atgggccttg acttccgcac cgacccggag acgctccgcg agatcgtcga cgatcccgcg        60
     gcactggcgg cccgcatcca caccctggcc gccctcgaca tggacgagca ccccgaagcc       120
     cgctccgagt acgccaccct cctgcgcatc gccggccgcc tcgacgacgc cgccctggag       180
     gccgaactca ccctcgccgc cgccgacctg gccggcgacc tccgccgcat ggtccgcgcc       240
     accctcctgg tcggccacgt ccgccaatac cgcggcgaat gggaccaggc cgacaccatg       300
     ttccaccgag cagagaaact tgccctgtat ctcaaggacg accgcctggt agccgccgcg       360
     gcccaccact ccggccgcag cttctacgac cagggcaagc acgtggaagc cgccctgcgc       420
     ttccgcctcg ccctggagat cgacacgagg atcggcagcc cgaaggtgtc cgccgtgtgg       480
     gaggcgttcg aggcggcgat ggcgaagttg taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page