(data stored in ACNUC7421 zone)

EMBL: CP001700.PE314

CP001700.PE314       Location/Qualifiers
FT   CDS_pept        complement(355850..356605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0316"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sgr:SGR_5042 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69269"
FT                   /db_xref="GOA:C7PVB3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU69269.1"
FT                   /translation="MLDYDLEAARYDQTRGGVERARAAADAVLELVPKDCAVLLDVACG
FT                   TGIVSELLRTPDRTVIGVDMAAGMLALARPRLGGTGRAVRGDATRLPLASGAVDAVTFM
FT                   WLLHLVDEAVVAAAVAEAARVLRPGGVMVTTVDKDSAQFGMNTDVGAIMRAARQELAPP
FT                   ASDQAERVRELAAAVGLEAAGTARYVGHGQGQTPKAWARRLREQAGWARRADPARIAEI
FT                   CRALEALPEQDVRRPDPEYVVASFRLDGH"
     gtgttggact acgaccttga agccgcccgc tacgaccaga cccgcggcgg cgtggagcgg        60
     gcccgcgcgg cggcggacgc ggtgctggag ctggtaccga aggactgcgc ggtgctgctc       120
     gatgtggctt gcgggaccgg catcgtgtcg gagctgctga ggacgccgga ccggacggtg       180
     atcggcgtcg acatggcggc cgggatgctg gcgctggccc gacctcggct cggcggcact       240
     ggacgcgcgg tgcgagggga cgcgacacgg ctgccgctgg cgtcgggagc ggtggacgcg       300
     gtgacgttca tgtggctgct gcatctggtc gacgaggcgg tggtggccgc ggcggtggcg       360
     gaggcggcgc gggtcctgcg gccgggcggg gtgatggtga cgacggtgga caaggactcc       420
     gcgcagttcg gcatgaacac cgatgtcggc gcgatcatgc gcgcggcccg gcaggagctg       480
     gcgccgccgg ccagcgacca ggcggagcgg gtgcgggagc tggcggcggc ggtgggcttg       540
     gaggccgcgg ggacggctcg gtacgtgggg cacgggcagg ggcagacgcc gaaagcgtgg       600
     gcccggcggc tgcgagagca ggcggggtgg gcgcggcggg cggatcccgc gcggatcgca       660
     gagatctgcc gcgcgctgga ggcgctgccg gagcaggatg tgcgccgacc ggatccggaa       720
     tatgtggtcg cgagcttcag actcgacggg cactga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page