(data stored in ACNUC7421 zone)

EMBL: CP001700.PE315

CP001700.PE315       Location/Qualifiers
FT   CDS_pept        356752..357615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0317"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sma:SAV_7083 Rif11-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69270"
FT                   /db_xref="GOA:C7PVB4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB4"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU69270.1"
FT                   /translation="MHPRTFRFAVVAALAPTAQAWQELARRAEELGYDTLLAPDTMTTL
FT                   EPFTALAAAATATERLRVGTFVLPAPFYPPSEIAWRALALDLLSGGRFDLGLGAGRPGA
FT                   EDEVVHRERRFGTPAERVKQLSDALHIVKEELAAAAAGRSPLKPVQKPHPPILVAAAGP
FT                   KMFQLAAAEADILTLGLDPRTTEDGLAAKIAELRAIAGSRVDDLELSYNLAGVGTELPG
FT                   FLSQQMGVDPAELIRTGAPAVLTGTPQEMADKLRRRRDTLGISYIAVNGMFLEQLAPVV
FT                   EMLAGK"
     atgcaccccc gcaccttccg cttcgccgtc gtcgcggccc tcgccccgac cgcccaggcc        60
     tggcaggagc tggcccggcg ggctgaggaa ctcggctacg acacgctgct ggccccggac       120
     accatgacca ccctggagcc gttcacggcc ctggccgccg ccgcgaccgc caccgagcgg       180
     ctgcgcgtgg gcaccttcgt cctgccggcg ccgttctacc cgccctcgga gatcgcctgg       240
     cgcgcgctgg cgctggacct gctctccggc ggacgcttcg acctgggcct gggcgccggc       300
     cgccccggag ccgaggacga ggtcgtgcac cgcgagcggc gcttcggcac gccggccgag       360
     cgcgtgaaac agctctctga cgccctgcac atcgtcaagg aggagctcgc cgccgcggcg       420
     gccggccgct ccccgctcaa gccggtccag aagccgcacc cgccgatcct ggtcgctgcc       480
     gccggaccca agatgttcca gctcgccgcc gccgaagccg acatcctgac cctcgggctg       540
     gacccgcgca ccaccgagga cggcctcgcg gcgaagatcg ccgagctgcg cgccatcgcg       600
     ggctcccgcg tcgacgacct cgaactcagc tacaacctgg ccggtgtcgg caccgagctg       660
     ccgggcttcc tgagccagca gatgggcgtc gatcccgccg aactcatccg caccggcgct       720
     ccggccgtcc tcaccggcac gccgcaggag atggccgaca agctgcgccg ccgccgcgac       780
     accctcggga tctcctacat cgccgtgaac ggaatgttct tggagcagct ggcgccggtg       840
     gtcgagatgc tggctggaaa atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page