(data stored in ACNUC7421 zone)

EMBL: CP001700.PE316

CP001700.PE316       Location/Qualifiers
FT   CDS_pept        complement(357646..358143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0318"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fre:Franean1_4116 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69271"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU69271.1"
FT                   /translation="MQAIRYTGRMLGKTYDSQVCSIARALEVVGERWSLLIVRDALFGG
FT                   ATRYSDFQRSLGIATNVLKTRLDGLVETGVMRRHQYSQQREQYEYLLTDKGRALAHSLV
FT                   ALSEWGDQWATDGEPPILYVHSVCGTGVTQKTVCAHCGVVEDPAEIRAEIGPGMPADRI
FT                   PA"
     atgcaagcga ttcgctacac tggacgcatg ctggggaaga cgtacgactc gcaggtgtgc        60
     tcgatcgcga gggcgctgga ggtggtcggc gagcgctgga gcctgctgat cgtgcgggac       120
     gcgctgttcg gcggcgcgac acggtacagc gacttccagc ggagcctggg gatcgcgacc       180
     aacgtgctca agacccgcct cgacggcttg gtcgagacgg gtgtcatgcg gcggcatcag       240
     tactcgcagc agcgggagca gtacgagtac ctgctgaccg acaaggggcg ggcgctggcg       300
     cactcgctgg tcgcgctctc ggagtggggc gaccagtggg cgacggatgg ggagccgccg       360
     attctttacg tgcactcggt gtgcgggacc ggggtcacgc agaagacggt gtgcgcgcac       420
     tgcggagtcg tggaggatcc ggcggagatc cgggccgaga tcgggccggg gatgccggcg       480
     gatcggattc cggcttag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page