(data stored in ACNUC7421 zone)

EMBL: CP001700.PE317

CP001700.PE317       Location/Qualifiers
FT   CDS_pept        358175..358705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_4690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69272"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69272.1"
FT                   /translation="MMQATAEQQQRPYTTGFTVARTPRAAYDAVLDVRGWWSAAVEGVT
FT                   DQVGGVFDYRFQDVHRCKVRVAELVPEQKVVWHVEENYFNFIADQTEWTGTDIVFEISP
FT                   APDGGAEIRFTHIGLLPQDECYDVCSNAWGGYIAGSLRALIETGQGHPNPKHDGDAPSH
FT                   QDAASAIRAERRP"
     atgatgcaag ccacagccga acagcagcag cgcccctaca ccaccggctt caccgtcgcc        60
     cggaccccgc gcgcggcgta cgacgccgtc ctcgacgtcc gcggctggtg gtccgcggcc       120
     gtcgagggag ttaccgacca ggtcggcggc gtcttcgact accggttcca ggacgtccac       180
     cgctgcaagg tccgggtcgc ggagctcgtc ccggagcaga aggtggtctg gcacgtcgag       240
     gagaactact tcaacttcat cgcggaccag accgaatgga cgggcactga catcgtcttc       300
     gagatctcgc cggcgccgga cggcggcgcc gagatccgct tcacccacat cggattgctc       360
     ccgcaggacg agtgctacga cgtctgctcc aacgcctggg gcggctacat cgccggcagc       420
     ctgcgcgccc tgatcgagac cggccagggc caccccaacc cgaagcacga cggagacgcc       480
     ccgtcccacc aggacgctgc ttccgccatc cgggccgagc gccggcccta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page