(data stored in ACNUC7421 zone)

EMBL: CP001700.PE318

CP001700.PE318       Location/Qualifiers
FT   CDS_pept        complement(358702..359427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0320"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69273"
FT                   /db_xref="GOA:C7PVB7"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB7"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACU69273.1"
FT                   /translation="MLSTEQLKEFGERGYVVVPGVVARNVVAKANKRIDELIAANPPAQ
FT                   GQVGHHFYFPAAADEPELLETLMDSAFGYAEALTGPGLLETPQQVQVALNIPPFSHRPG
FT                   RPHIDAAISEPTPGFTPNSFTLLAGVFVTDQLRENSGNLWVWPGTHRTHAEYFRERGIE
FT                   MYCAYPDIELPEPEQVTARAGDLLLAHYLLGHNIGGNYESDTTRRMLYYRVSGRGHAEG
FT                   PERILTEPWYEYGPVRALI"
     gtgttgagca ctgaacagct gaaggaattc ggcgagcggg ggtacgtcgt cgtcccgggt        60
     gtggtggctc ggaacgtcgt ggcaaaagcg aacaagcgga tcgacgagct gatcgccgcc       120
     aacccgccgg cgcagggaca ggtcggccac cacttctact ttccggcggc ggcggacgag       180
     ccggagttgc tcgagacgct gatggacagc gctttcgggt acgccgaggc gctgaccggt       240
     cccgggcttc tggagacgcc gcagcaggtg caggtggcgc tgaacatccc gccgttctcg       300
     caccggccgg ggcggccgca catcgacgcc gcgatcagcg agccgacgcc gggcttcacg       360
     ccgaacagtt tcacgctgct ggccggcgtg ttcgtcaccg accagctgcg ggagaactcg       420
     gggaacctgt gggtctggcc ggggacgcac cgcacgcacg cggagtactt ccgcgagcgc       480
     ggcatcgaga tgtactgcgc gtacccggac atcgagctgc ccgagccgga acaggtcacc       540
     gcgcgcgccg gcgacctgct gctcgcgcac tatctgctcg ggcacaacat cggcgggaac       600
     tacgagtcgg acacgacgcg gcggatgctg tactaccggg tcagcggtcg cgggcacgcc       660
     gagggtccgg agcggatcct gaccgagccc tggtatgagt acggccctgt tcgtgccctg       720
     atttag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page