(data stored in ACNUC7421 zone)

EMBL: CP001700.PE319

CP001700.PE319       Location/Qualifiers
FT   CDS_pept        complement(359470..360339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0321"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: nfa:nfa16290
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69274"
FT                   /db_xref="GOA:C7PVB8"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB8"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ACU69274.1"
FT                   /translation="MRLVIDGIDLTTLAIPFYVLFMALELLSLRFFPDPVEQGYTVKDT
FT                   ATSLTMGIGSIVCNLGWGLVTVAAVAGVHALAPWHIASSLTGWLVLFVAYDFFYYWEHR
FT                   ANHRVRILWASHVVHHSSRHYNLSTALRQTWTGVGNTIFLLPLALVGFPSYMIFATAAM
FT                   NLLYQFWIHTERIATMWRPIEFVMNTPSHHRVHHGSNQGYLDKNYGGVFIVFDRLFRSF
FT                   EPEGEPVEYGLTKNIGTFNPLRVAAHEYAAIARDVRGAAGWRARFGYVLRGPGWSPASP
FT                   VPATAVTV"
     atgcgccttg tgatcgacgg catagacctc acgaccctcg cgatcccctt ctatgtgctg        60
     ttcatggcac tggagctgct ctcgctgcgg ttcttcccgg acccggtcga gcagggctac       120
     accgtcaagg acaccgcgac gtcgctgacg atgggcatcg gctcgatcgt ctgcaacctc       180
     ggctggggac tggtgacggt cgccgcggtg gccggcgtgc acgcgctcgc gccgtggcat       240
     atcgccagtt cgctgaccgg ctggctcgtg ctcttcgtgg cgtacgactt cttctactac       300
     tgggagcacc gcgccaacca ccgcgtccgc atcctgtggg cgtcgcatgt ggtgcaccac       360
     tccagccggc actacaacct gtccacggcg ctgcgccaga cctggaccgg ggtcggcaac       420
     acgatcttcc tgctgccgct ggcgctggtc gggttcccgt cgtacatgat cttcgcgacg       480
     gcggcgatga acctgctcta ccagttctgg atccacaccg agcggatcgc cacgatgtgg       540
     cgcccgatcg agttcgtgat gaacacgccc tcgcaccacc gcgtgcacca cggctcgaac       600
     cagggctacc tggacaagaa ctacggcggc gtgttcatcg tcttcgaccg gctgttccgg       660
     tctttcgagc ccgagggcga gccggtggag tacgggctga cgaagaacat cgggacgttc       720
     aatccgctgc gtgtcgcagc gcacgaatac gccgcgatcg cgcgggacgt gcgcggcgcc       780
     gcaggctggc gggcacggtt cggttacgtg ctgcgcggcc cgggctggtc gccggcgagc       840
     ccggtgccgg cgaccgcggt gacggtctaa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page