(data stored in ACNUC7421 zone)

EMBL: CP001700.PE32

CP001700.PE32        Location/Qualifiers
FT   CDS_pept        31496..32140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0032"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rpc:RPC_2940 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68987"
FT                   /db_xref="GOA:C7QFP8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU68987.1"
FT                   /translation="MTTDPKAIIESGYDAVAEEYLSTFGEGVPDDPRVRFIGALGEHLA
FT                   DGARVLELGCGAGIPATALLAQRFDVLGVDISAGQLALAAQRVPTAEFRKADMTSLDLP
FT                   AGSFDAVTAFYSFNHIPRAEQQPLLTAIARWLRPGGLLLASFGRGGSADDVELWLGGVP
FT                   MFFASHDPATNTRHLADAGFTPLVDELVSMETGRGSETWQWVLARSGERRR"
     atgacgaccg atccgaaggc gatcatcgag tccggatacg acgccgtggc cgaggagtac        60
     ctgtccacgt tcggcgaagg cgtccccgac gacccccgcg tccgcttcat cggcgcgttg       120
     ggcgaacacc tcgccgacgg cgcgcgcgtc ctcgagctcg gctgcggcgc cggcatcccc       180
     gccacggcct tgctggcgca gcgtttcgac gtgctcggcg tcgacatctc ggcgggccag       240
     ctggcgctcg ccgcgcagcg cgtgccgacg gccgagttcc gcaaggcgga catgacgagc       300
     ctggacctgc cggcgggctc tttcgacgcg gtcacagcct tctacagctt caaccacatc       360
     ccccgcgccg agcagcagcc gctcctgacc gcgatcgccc gctggctgcg ccccggcggc       420
     ctgctgctgg cgtcgttcgg ccgcggcggc tccgccgacg acgtcgagct ctggctcggc       480
     ggcgtcccca tgttcttcgc cagccacgac cccgccacca acacccgcca cctcgccgac       540
     gccggtttca caccgctcgt cgacgaattg gtgagcatgg agacgggcag ggggagcgag       600
     acgtggcagt gggtgctggc gcgctctggg gagcggcggc gctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page