(data stored in ACNUC7421 zone)

EMBL: CP001700.PE320

CP001700.PE320       Location/Qualifiers
FT   CDS_pept        complement(360412..361983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0322"
FT                   /product="TROVE domain protein"
FT                   /note="PFAM: TROVE domain protein; KEGG: nfa:nfa39620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69275"
FT                   /db_xref="GOA:C7PVB9"
FT                   /db_xref="InterPro:IPR008858"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB9"
FT                   /inference="protein motif:PFAM:PF05731"
FT                   /protein_id="ACU69275.1"
FT                   /translation="MAKFNKTATKTAKTFEGGKAYKRDPKADLFLLAVTNMVGEDTFYE
FT                   SADTRDERYRDLVHAVAVSDPEWMLRFVTWLRAEANMRSAAVVAACESVRARLDAEASG
FT                   YGRQLIAAACQRADEPGEVLAYWTGRYGRALPKPVKRGVADAVAHLYNEYSFAKYDSDA
FT                   KGFRFGDVIDLVHPAAAADKPWQGELFRHALDRRHNRDNPVPEALPKLAKRAALLGLPV
FT                   AERRGVLLAEGGAQRLAEAGMTWEALAGWLQGPMDQAAWEAVIPSMGLMALARNLRNFD
FT                   EAGVADAVAWRVCSRFLDAGQVGRSRMLPYRWLSAYKAAPSLRWGHALEGALGHAIAGV
FT                   PELPGRTLVLVDTSGSMTGRVSARSTVTHLDIGALIGVALADRAAGSGRADDVDLVGFA
FT                   DGVFRHELTKGGSVLRGIEAFAKRSGEVGHGTRMIDAIAATYDRHDRVVIVSDMQAFPY
FT                   FYHQNKGADAFIPDTVPVFGINTAGYGPSALPPGKRNRFEIGGFSDKVFTLFGLLASGD
FT                   DPALPF"
     atggcgaagt tcaacaagac agcgaccaag accgccaaga ccttcgaggg cggcaaggcc        60
     tacaagcgcg acccgaaggc ggacctgttc ctgctcgcgg tcacgaacat ggtcggcgag       120
     gacaccttct acgagtccgc cgacacccgt gacgagcgct accgcgatct cgtgcacgcc       180
     gtcgccgtct ccgaccccga gtggatgctg cgcttcgtca cctggctgcg tgccgaggcg       240
     aacatgcgca gcgccgccgt cgtcgcggcg tgcgagtccg tgcgggcccg gctggacgcg       300
     gaggcgtccg ggtacggccg ccagctgata gccgccgcgt gtcagcgtgc tgacgagccc       360
     ggcgaggtcc tggcgtactg gaccggccgc tacggccgcg cgctgccgaa gccggtgaag       420
     cgcggtgtcg ccgacgccgt ggcgcacctg tacaacgagt actcgttcgc gaagtacgac       480
     tcggacgcca agggcttccg cttcggcgac gtcatcgatc tcgtgcaccc cgctgccgcg       540
     gccgacaagc cttggcaggg cgagctgttc cggcacgcgc tggaccgccg ccacaaccgg       600
     gacaacccgg tgccggaggc actgccgaag ctggccaagc gggctgcgct gctcgggctg       660
     ccggtggcgg agcggcgcgg tgtgctgctc gccgagggcg gcgcgcagcg cctggccgag       720
     gcgggcatga cgtgggaggc gctggccggc tggctgcagg gcccgatgga ccaggccgcc       780
     tgggaggcgg tcatcccgtc gatgggtctg atggcgctgg cgcggaacct gcggaacttc       840
     gacgaggccg gggtcgccga cgcggtggcg tggcgggtct gctcgcggtt cctggacgcc       900
     ggccaggtgg gacggtcgcg gatgctgccg taccggtggc tgtcggcgta caaggccgcg       960
     ccgtcgctgc ggtggggaca cgcgctggag ggggcgctgg ggcacgcgat cgccggcgtc      1020
     ccggagctgc cggggcgcac cctggtcctg gtcgacacct ccgggtcgat gaccggccgg      1080
     gtgtcggcgc gctcgacggt cacgcacctg gacatcggtg cgctgatcgg ggtcgcgctg      1140
     gcggaccgcg cggcgggctc cggacgcgcc gacgacgtgg acctcgtcgg tttcgccgac      1200
     ggcgtcttca ggcacgagct gaccaagggc ggcagcgtcc tgcgcgggat cgaggcgttc      1260
     gccaagcgct ccggcgaggt cgggcacggc acccgcatga tcgacgcgat cgcggcgacc      1320
     tacgaccggc acgaccgcgt ggtgatcgtc agcgacatgc aggcgttccc gtacttctac      1380
     caccagaaca agggcgcgga cgcgttcatc ccggacacgg tcccggtctt cgggatcaac      1440
     accgcgggct acggtccgag cgcgcttccg cccggcaagc ggaaccggtt cgagatcggc      1500
     gggttctcgg acaaggtgtt caccctgttc ggactgctcg cctccgggga cgacccggcg      1560
     ctgccgttct ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page