(data stored in ACNUC7421 zone)

EMBL: CP001700.PE321

CP001700.PE321       Location/Qualifiers
FT   CDS_pept        complement(362213..363790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0323"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_5254 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69276"
FT                   /db_xref="GOA:C7PVC0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69276.1"
FT                   /translation="MSTNSPPSGRRQRLILTVLIFAQLLIWIDGTVLSTAYETLADPVR
FT                   GLGATPGQLQWATGSYTLVLATVTFTGGALGDRFGHRNTLLAGMALFGLASVFAAYSQN
FT                   TGQLIAARAVMGLGAALLIPATLAVISFTYPPEQRPQAFGVLSSFAGVGIAAGPVLAGL
FT                   MLANFWWGSVFLINVPVVVLGLVAIARTVPNFQPPAKRGLDFPGLLLSSAGLGLLSYGL
FT                   IRAGQDGTVTEPQVWITVAGGLVVTAAFVVVELRRRHPSFDPRLFRLRQFAAGNVSLTL
FT                   LFLALSASGFYFAFYLQGARGYSALRASLVGIPGALGVVIGGPVAAKLARRTSVRRVSG
FT                   TALTVSTITLLVFSRVGLGLPIPAYIAVSIVQATAIGMTIAPLTGAILGSLPLAQAGAG
FT                   SAVNATMRQTGSVLGIALGGTILSIGYRHAIGGSVAALPAPLKQQAETSAEMARNVARH
FT                   NGIPNLAHQADLAFVHAMHTGMVWSAAATGIGALLVFGAFANPRKTKTEAVTAQLEAST
FT                   VVPESASA"
     atgtccacga acagcccgcc gtccggccga cggcagcgcc tgatcctgac cgtcctgatc        60
     ttcgcgcagc tcctgatctg gatcgacggc accgtcctgt ccaccgccta cgaaaccctc       120
     gccgacccgg tccgcggcct gggcgccact cccggccagc tccagtgggc caccggctcc       180
     tacacgctgg tcctggccac cgtcaccttc accggcggcg ccctcggcga ccgcttcggg       240
     catcgcaaca ccctgctggc cggcatggcg ctgttcggac tggcctcagt gttcgccgcg       300
     tactcgcaga acaccgggca gctcatcgcg gcccgcgccg tcatgggcct gggcgccgcg       360
     ctgctgatcc cggcgacgct ggcggtgatc agcttcacct acccgcccga gcagcgcccg       420
     caggccttcg gcgtgctcag cagtttcgcc ggggtgggca tcgccgccgg accggtgctg       480
     gccggtctga tgctggcgaa cttctggtgg ggctcggtgt tcctgatcaa cgtgccggtg       540
     gtggtgctcg gcctggtcgc gatcgcccgg accgtgccga acttccagcc gccggccaag       600
     cgaggactgg acttccccgg tctgctgctc tcctccgccg gcctcggtct gctgtcctac       660
     ggcctgatcc gggccgggca ggacggcacc gtgaccgaac cgcaggtatg gatcaccgtc       720
     gccggcgggc tggtggtgac cgccgcgttc gtggtcgtgg agctgcgccg ccgacacccg       780
     agcttcgacc cgcggctgtt ccgcctgcgc cagttcgccg ccggcaacgt ctccctgacg       840
     ctgctgttcc tcgccttgag cgcgagcggt ttctacttcg ccttctacct ccaaggcgcc       900
     cgcggctact cggccctgcg cgccagcctg gtcggcatcc ccggcgcgct cggcgtcgtc       960
     atcggcggac cggtcgccgc gaagctcgcg cgccgtacct cggtccgccg ggtcagcggc      1020
     accgcgttga cggtctccac gatcacgctc ctggtcttct cccgggtcgg cctcgggttg      1080
     ccgatccccg cctacatcgc cgtgtcgatc gtccaggcca ccgcgatcgg catgaccatc      1140
     gccccgctga ccggcgcgat cctcggctcg ctgccgctgg cccaagccgg ggcgggcagc      1200
     gcggtgaacg ccaccatgcg ccagaccggc agcgtgctgg gcatcgcgct cggcggcacg      1260
     atcctgtcga tcggataccg gcacgcgatc ggcggctcgg tggccgccct gcccgcgcca      1320
     ctgaaacagc aggctgagac gtccgccgag atggcccgga acgtcgcgcg gcacaacggg      1380
     atcccgaacc tggcgcatca ggcggacctc gcgttcgtgc acgcgatgca caccggaatg      1440
     gtgtggtcgg cggcggcgac cgggatcggg gcgctgctgg tgttcggcgc gttcgcgaac      1500
     cccaggaaga ccaagaccga ggcggtcacg gcacagcttg aggcatcgac agtggttccg      1560
     gaatcggctt cggcatag                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page