(data stored in ACNUC7421 zone)

EMBL: CP001700.PE322

CP001700.PE322       Location/Qualifiers
FT   CDS_pept        364025..364477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0324"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bbt:BBta_4007 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69277"
FT                   /db_xref="GOA:C7PVC1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69277.1"
FT                   /translation="MSTSDKLGEDGVVSFAIRHVWLGMRAVIEDELTEFGLTVPQFATL
FT                   MMLDSSPGLTVAEVARACGTTRQSANEMVAGLESRGLVERAAHPTDRRAHQLHATEAGL
FT                   EMYAKARPAVRRREEELEAGLSPQVRQAAREWMAAIAISCGLPDKK"
     atgtccacgt ctgacaagct cggcgaggac ggcgtcgtca gcttcgccat ccgccacgtc        60
     tggctcggca tgcgcgccgt catcgaggac gagctcaccg agttcggact gaccgttccg       120
     cagttcgcga ccctgatgat gctcgacagc tccccggggt tgaccgtcgc cgaggtggcg       180
     cgggcctgcg gcacgacccg gcagtccgcg aacgagatgg tcgccggcct ggaatcccgc       240
     ggcctggtcg agcgcgccgc gcacccgacg gaccggcgcg cgcaccagct gcacgcgacc       300
     gaggcgggcc tggagatgta cgcgaaggcg cggccggcgg tgcggcgccg cgaggaggag       360
     ctggaggccg ggctcagccc gcaggtgcgg caggccgcca gggagtggat ggcggcgatc       420
     gcgatctcgt gcggcttgcc ggacaagaag tag                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page