(data stored in ACNUC7421 zone)

EMBL: CP001700.PE323

CP001700.PE323       Location/Qualifiers
FT   CDS_pept        364672..365445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69278"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC2"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03810"
FT                   /protein_id="ACU69278.1"
FT                   /translation="MSTSLLFTSDSSADGVRERDFTVGGVPGVLWSPDSRPDRAPLVLI
FT                   GHGGGIHKKAPGSAGRARALVLGCGFHVAAIDAPGHGDRPRTEHDEREIDALFAARDAG
FT                   EPEGPIVVRYNAYLAEQAVPEWRATLDALQELREIGADGPVGYWGINMGTAIGIPFVAA
FT                   DPRITAAVFGQHWPDFLAEPAKRITIPVEFDLQWDDEHIPRSAGLALFDAFASPEKTLH
FT                   ANAGRHKQLPRFEADSAVRFFARHFGAPAAGTAAA"
     atgtctactt cacttctttt caccagtgat tcctccgcgg acggtgtccg cgaacgcgac        60
     ttcaccgtgg gcggcgtccc cggtgtcctg tggtcgccgg actcccgtcc cgaccgcgcg       120
     cccctggtcc tgatcggcca cggcggcggc atccacaaga aggcgcccgg cagcgccgga       180
     cgcgcccgcg cgctggtgct cggctgcggg ttccacgtcg ccgccatcga cgcgcccggc       240
     cacggcgacc gcccgcgcac cgagcacgac gagcgcgaga tcgacgcgct gttcgcggcg       300
     cgcgacgccg gcgagccgga gggcccgatc gtcgtgcgct acaacgccta tctggccgag       360
     caggccgtgc cggagtggcg cgcgaccctg gacgcgctcc aggaactgcg cgagatcggc       420
     gccgacggtc cggtcggcta ctggggcatc aacatgggca cggcgatcgg tatcccgttc       480
     gtcgccgccg acccccggat cacggccgcc gtcttcggcc agcactggcc ggacttcctg       540
     gccgagccgg cgaagcggat cacgatcccg gtcgagttcg atctgcagtg ggacgacgag       600
     cacatcccgc gctcggccgg tctggcgctg ttcgacgcct tcgcctcgcc ggagaagacg       660
     ttgcacgcca acgccgggcg gcacaagcag ctgccccggt tcgaggcgga cagcgccgtc       720
     cggttcttcg ctcggcactt cggtgccccg gccgccggca cggcggccgc gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page