(data stored in ACNUC7421 zone)

EMBL: CP001700.PE324

CP001700.PE324       Location/Qualifiers
FT   CDS_pept        complement(365498..366184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69279"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69279.1"
FT                   /translation="MAEPHAAWGMRQIEEFNEFLPIGPWTVNLDERRYRQSGRELRISV
FT                   LGSFDTAEGSWLWGWANPGFGKLPVVAAAEALRSFGLDHGVPEFSEELVDLSGFEDPRY
FT                   AAEMLAFGAMGVLRADGYIGVQANETGRLYMVPDDPQVPVADPDPIALPRLLMQGAQFF
FT                   NRSAYEVVAGYFHHFTIPWRQEGDTITAELPGGATASVQFDGQGRVAAVSMGSITKESL
FT                   GNTADA"
     atggcggagc cccacgcggc ctggggcatg cgccagatcg aggagttcaa cgagttcctg        60
     ccgatcgggc cgtggacggt gaacctggac gagcggcggt atcggcagtc ggggcgggag       120
     ctgcggatca gtgtgctcgg gagcttcgac accgcggagg gttcgtggtt gtgggggtgg       180
     gcgaaccccg ggttcgggaa gctgccggtg gtggccgcgg ctgaggcgct gcggtcgttc       240
     gggctggatc acggggtgcc cgagttctcc gaggagctgg tggacctctc gggcttcgaa       300
     gacccccggt atgccgcgga gatgctggct ttcggggcga tgggggtgct gcgtgccgac       360
     ggctacatcg gcgtgcaggc caatgagacc gggcggctgt acatggtgcc ggacgatccg       420
     caggtgccgg tcgccgatcc ggatccgata gcgctgcccc gactgctgat gcagggggcg       480
     cagttcttca accggtcggc gtacgaggtg gtcgccggct acttccacca cttcaccatc       540
     ccgtggcggc aggagggcga caccatcacc gccgagctgc cgggcggggc gaccgcgtcg       600
     gtccagttcg acgggcaggg acgggtcgcc gcggtgtcga tgggctcgat caccaaggaa       660
     tcgctgggga acaccgccga cgcctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page