(data stored in ACNUC7421 zone)

EMBL: CP001700.PE325

CP001700.PE325       Location/Qualifiers
FT   CDS_pept        complement(366387..367406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0327"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein MerR; KEGG: fre:Franean1_1870
FT                   helix-turn-helix type 11 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69280"
FT                   /db_xref="GOA:C7PVC4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC4"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACU69280.1"
FT                   /translation="MNHPAGRVLTLLELLQSGGVRTAAEIAERLGVDARTVRRYVEQLL
FT                   ELEIPVESVRGRYGGYRLARGFRLPPLMLGDDEALAVLLGLLAGRRSGLTAALGAAGET
FT                   AGAKIRRVLPARLSERLRSVLDSVAFTGAPDQSAALDATVLLTVADAVANQRPIAVRYT
FT                   GRDGVRGDRTLHPYAIVSHGERWYVRALDPAIGEERTFRLDRIDGARALPGSFEAPTMD
FT                   DDPGQSLLAGFAAADYRYEVAIRVHGTVEQIRARFPVSVATIQPLSDANGNGDGNGNGN
FT                   EAQTPWHRLAIRAEHLDWIPPTLAALDLPFEIEDPDELRDLVIAFADRLATRARGGLE"
     gtgaatcacc ccgccggacg tgtgctgacg ctgctggagc tcctgcagtc cggaggcgtg        60
     cgcacggcgg ccgaaatcgc cgaacggctc ggggtcgatg cgcgcacggt gcggcggtac       120
     gtggagcagc tgctggagtt ggagatcccc gtggagtccg tgcgcgggcg ttacggcggc       180
     taccggctgg ctcgcggctt ccggctgccg ccgctgatgc tgggtgacga cgaggcgctg       240
     gcggtactgc tgggactgct cgccgggcgg cggagcgggt tgacggcggc gctcggagcg       300
     gcgggagaga cggcgggcgc caagatccgg cgggtgctgc ccgcacggtt gtccgagcgg       360
     ctccggagcg tgctggacag tgtggcgttc accggcgcac ccgatcagag cgctgcgctg       420
     gatgccacgg tgttgctcac ggtcgccgat gccgtggcga atcagcggcc gatcgctgtg       480
     cgatacaccg gccgcgacgg tgttcgcggt gaccggacac tgcatcccta tgcgatcgtg       540
     agccatgggg agcgctggta tgtcagggct ctggatccgg caatcggcga ggagcgcacg       600
     tttcggcttg atcggatcga cggggcaagg gcgctgccgg gttctttcga ggcgccgacg       660
     atggacgatg atccggggca gagcttgctc gccgggttcg cggcggcgga ctaccggtac       720
     gaagtcgcga tccgagtaca cgggacggtc gagcagatcc gggcgcggtt tccggtgagt       780
     gtggcgacaa ttcagccgct cagcgatgcc aacggcaatg gcgatggcaa cggcaacggc       840
     aacgaggcac agaccccatg gcaccgcctc gccatccgcg ccgaacacct cgactggatc       900
     ccgccgacgt tggccgcact cgacctgccc ttcgagatcg aagacccgga cgaactccgc       960
     gatcttgtca tcgcctttgc cgaccgcctg gcgacgagag cacgcggcgg actcgaatag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page