(data stored in ACNUC7421 zone)

EMBL: CP001700.PE326

CP001700.PE326       Location/Qualifiers
FT   CDS_pept        367470..367901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0328"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sco:SCO4486 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69281"
FT                   /db_xref="GOA:C7PVC5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69281.1"
FT                   /translation="MTTNLASTRIITADIASLVAFYEKATALPATWATPDFAELATPAG
FT                   ATLAIGSTRTVPLFAPDSAAPGANRSVIIEFLVDDVDALWQRLAAWIPASDVVAEPKTL
FT                   PWGNRSLLVRDPDGTLVNFFTPVTPEARAKYGLSALIES"
     atgactacaa acctcgcgtc gacccgcatc atcaccgccg acatcgccag cctggtcgcc        60
     ttctacgaga aggccaccgc cctgcccgcc acctgggcca ccccggactt cgccgagctc       120
     gccacccccg ccggcgcgac cctcgcgatc ggcagcaccc gcaccgtccc gctgttcgcc       180
     cccgacagcg ccgccccggg cgccaaccgc agcgtgatca tcgagttcct ggtggacgac       240
     gtcgacgccc tctggcagcg cctcgccgcc tggattcccg cctccgacgt cgtcgccgag       300
     ccgaagaccc tgccctgggg caaccgctcc ctgctggtcc gcgaccccga cggcaccctg       360
     gtcaacttct tcacgccggt gacgcccgag gcgcgcgcga agtacggact cagcgctctg       420
     atcgagtcct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page