(data stored in ACNUC7421 zone)

EMBL: CP001700.PE327

CP001700.PE327       Location/Qualifiers
FT   CDS_pept        complement(367879..368469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0329"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mab:MAB_1873c
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69282"
FT                   /db_xref="GOA:C7PVC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69282.1"
FT                   /translation="MTADPSSPAQQQLRADALRNRESVLAAATAAFAASEAEPSMREIA
FT                   RQAGVGVATLYRHFPTREALVDAVYQDQVVRLTAGARDLLAAHPPARALRLWMDLFADW
FT                   LTTKRGMTGTLLAMVDAGDISLAHTRGELLAAIATILDAGIAAGEIRADTSAEDVSAAV
FT                   LGLLAVSGERGNPEQAQRLLDVLMDGLRTRSER"
     atgaccgccg atccgtcctc ccccgcgcag cagcagctgc gggctgacgc gctgcgcaat        60
     cgcgagagcg tgctcgccgc cgcgaccgcc gcgttcgccg cttccgaggc cgagccgtcg       120
     atgcgcgaga tcgcccggca ggccggggtc ggcgtcgcca cgctctaccg ccacttcccg       180
     acccgggagg cgctcgtcga cgccgtgtat caggaccagg tcgtgcggct gaccgccggg       240
     gcgcgcgacc tgctcgccgc gcatccgccg gcgcgggcgc tgcggctgtg gatggacttg       300
     ttcgccgact ggctgacgac caagcgcggg atgaccggca cgctgctcgc catggtcgac       360
     gccggggaca tctcgctagc gcacacgcgc ggggagctcc tggcggcgat cgcgacgatc       420
     ctcgacgccg ggatcgccgc cggagagatc cgcgcggaca ccagcgccga ggacgtcagc       480
     gctgcggtgc tcggtctgct cgctgtttcg ggcgaacgcg ggaatcccga gcaggcgcaa       540
     cgacttctcg acgtcctgat ggacgggctc aggactcgat cagagcgctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page