(data stored in ACNUC7421 zone)

EMBL: CP001700.PE328

CP001700.PE328       Location/Qualifiers
FT   CDS_pept        368589..369569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0330"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fal:FRAAL3688 putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69283"
FT                   /db_xref="GOA:C7PVC7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC7"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACU69283.1"
FT                   /translation="MADRITPPDTMRTVRFREYGEPADVLRLEIASVPAPSPGRIRIAV
FT                   HACGLAPADWALCRGLFAGDLPRGIGCDVAGTVEAVGEGVTDVAIGDPVFGTADYAGQP
FT                   SAGAADHAIMDHWYTVPEGLDLIQAAALPMALSTAYWHLTRLGLSAGSTLLVNGAGTTI
FT                   GYAAVQIALHRGLHVIATAGETYAPQLKNLGATVTAYGDGLPDRVAALSDTPIDIVFDT
FT                   APPNGALPDLIRIADDDPQRILTCSDLATAPDLGARDTFHEDRTTFTDADRFSHFPEFA
FT                   HLAAKGKFTVPVAGTFPLDQWRTALDISQSGHARGKLLLLPGSQR"
     atggctgacc gcatcacacc tcccgacacc atgcgcacgg tgcgcttccg cgagtacggc        60
     gagcccgccg acgtgctccg cctggaaata gcatccgtcc ccgcaccgag ccccggccgc       120
     atccgcatcg ccgtccacgc ctgcggcctc gcccccgccg actgggccct gtgccgcggc       180
     ctgttcgccg gcgacctgcc gcgcggcatc ggctgcgacg tcgcgggcac cgtcgaagcc       240
     gtcggcgaag gcgtcacgga cgtcgcgatc ggcgaccccg tcttcggcac cgccgactac       300
     gccggccaac ccagcgcagg cgcggcagat cacgcgatca tggaccactg gtacaccgtc       360
     cccgaaggac tggacctcat ccaagccgcc gcactcccga tggcactgag caccgcctac       420
     tggcacctca cccgcctcgg cctctcagca ggcagcacac tgctggtcaa cggcgccgga       480
     accaccatcg gctacgcagc ggtccagata gccctccatc gcggtctcca tgtgatcgcc       540
     accgccggcg agacctacgc cccgcagctg aagaacctcg gcgccacagt caccgcctac       600
     ggcgacggcc tccccgaccg agtcgcagcc ctcagcgata ccccgatcga catcgtcttc       660
     gacaccgcac cccccaacgg cgccctcccc gacctcatcc gcatcgccga cgacgacccc       720
     cagcgcatcc tgacctgctc cgacctggcc accgcaccag acctcggcgc acgcgacacc       780
     ttccacgagg accgcaccac cttcaccgac gccgaccgct tcagccactt ccccgagttc       840
     gcacacctcg ccgccaaggg aaagttcacc gtgccggtgg caggtacctt cccgctcgac       900
     caatggcgca cagcgttgga catcagccag tccggacacg cccgaggcaa gctcctgctc       960
     ctacccggca gccagcgttg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page