(data stored in ACNUC7421 zone)

EMBL: CP001700.PE329

CP001700.PE329       Location/Qualifiers
FT   CDS_pept        369649..370095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0331"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rha:RHA1_ro06883
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69284"
FT                   /db_xref="GOA:C7PVC8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU69284.1"
FT                   /translation="MDDVEVVDRISGRVILLDPNGRALLFQGFDPQRPNQLWWITPGGG
FT                   LEPGETPQQAAARELQEETSLDVQPQDLGEAVFRNYVEFFFDGRLLRQHNHFFTLRTEP
FT                   FEISTAGFDALEQRTHLTHRWWTLEELRTTDETFFPEELPDLLS"
     atggacgacg tcgaggttgt ggaccgcatc tcaggccgag tgattctgct cgacccgaac        60
     ggccgagcgc tgctgtttca aggcttcgac ccacaacgcc cgaatcagct ctggtggatc       120
     acccccggcg gcggcctgga accaggagag actccccagc aagccgccgc gcgtgagctc       180
     caagaagaga ccagcctcga cgtccaaccg caggacctgg gcgaggcagt cttccgcaac       240
     tacgtggagt tcttcttcga tggccgccta ctgcgccaac acaatcactt cttcacactc       300
     cgcaccgagc ccttcgagat ctcaacagcc ggcttcgacg cactggagca gcgcacccac       360
     ctcactcacc gctggtggac cctcgaagag ctccgcacga ccgacgagac cttcttcccc       420
     gaggaactcc ccgacctgct cagctag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page