(data stored in ACNUC7421 zone)

EMBL: CP001700.PE33

CP001700.PE33        Location/Qualifiers
FT   CDS_pept        33113..34141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0033"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: sco:SCO3843 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68988"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU68988.1"
FT                   /translation="MGVLQRFERRIEGLVNGAFAKAFKSEVQPVEIASALQRECDDRAA
FT                   IVSQGRTMVPNDFTVELGGVDYERLATYAGPLGAELAELVREYGAEQRYMFVGPVEVKF
FT                   ARAADLDTGMFRIQSQALAGVVPVSSMQGEPQGYDPYGQPPPYQGGPQGGPQGPGGPQG
FT                   PGGPQGPGGLQPVPPPNPVPQPAPWGSPPPPQGQGGPQPGWGAPPPGQGGYDQGGYDPY
FT                   GQPPPQQPGWGPPGQQQQQQQYAPPPQSQTQCWVEINGARHMLTKPVTTMGRGTDVDLR
FT                   VDDPSVSRRHAEIRIGTPSYVSDLGSTNGIVVDNQHVTQAPLRDGSVIHLGTTTIIFRQ
FT                   QG"
     gtgggagtcc tacagcggtt cgagcgacgc atcgaagggt tggtcaacgg cgccttcgcc        60
     aaggcattca agtccgaggt ccagccggtg gagatcgcct ccgcgctgca gcgcgagtgc       120
     gacgaccggg cggccatagt cagccaggga cggaccatgg tgcccaacga cttcacggtc       180
     gagttgggcg gcgtggacta cgagcggctg gcgacctacg ccggtcccct gggcgctgaa       240
     ctcgccgaac tcgtccgtga gtacggtgcg gaacagcgct atatgttcgt cggaccggtc       300
     gaggtgaagt tcgcgcgtgc ggccgatctc gacacgggga tgttccggat ccaaagtcag       360
     gcgttggcag gagtggtgcc cgtgtcctcg atgcaaggcg agccccaggg ctacgacccc       420
     tacggccagc ctccccccta ccagggcggc ccacagggcg gtccgcaggg cccgggtgga       480
     ccccagggcc caggcggtcc ccagggcccc ggcggcctgc agcccgtgcc gccgccgaac       540
     cccgtgccgc agcccgcgcc gtggggatcc ccgccgcccc cgcaggggca gggcggtccc       600
     cagcccggct ggggcgcgcc gcctcccggc cagggcggct acgaccaggg cgggtacgac       660
     ccgtacggcc agccgccgcc gcagcagccc ggctggggtc cccccggcca gcagcagcaa       720
     cagcagcagt acgcgccgcc gccgcagtcc cagacccaat gctgggtgga gatcaacggc       780
     gcgcggcaca tgctgaccaa gccggtcacc accatgggcc gcggtaccga cgtcgacctg       840
     cgggtcgacg acccgtcggt gtcgcgccgg cacgccgaga tccggatcgg gactccgtcc       900
     tacgtctcgg acctgggctc caccaacggc atcgtggtcg acaaccagca cgtcacgcag       960
     gctcccctgc gcgacggctc ggtgatccac ctgggcacga cgaccatcat cttccggcag      1020
     cagggctaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page