(data stored in ACNUC7421 zone)

EMBL: CP001700.PE330

CP001700.PE330       Location/Qualifiers
FT   CDS_pept        complement(370550..371932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0332"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: sgr:SGR_3669 putative replicative DNA
FT                   helicase; TIGRFAM: replicative DNA helicase; PFAM: DnaB
FT                   domain protein helicase domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69285"
FT                   /db_xref="GOA:C7PVC9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC9"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACU69285.1"
FT                   /translation="MSIDDLPYTADEAYQGGFERTPPQDIPAEQSVLGGMLLSKDAIAE
FT                   VIEVIKAIDFYKPAHEAVFGAILELYGRGEPADPVTVAALLTKKGDINRIGGAPYLHTL
FT                   INSVPTAANAGYYAEIVKERAVLRRLVEAGTRIVQMGYSTDGSDVEQIVDAAQQEMYNV
FT                   TEARTSEDFIPLADAMEGALDEIESISNRSGQMTGVPTGFHDLDALTNGLHPGQMVIIA
FT                   ARPAIGKSTLGLDLARSCSIKNGLTSVIFSLEMGRNEIIMRLLSAEARVALHHMRSGTM
FT                   TDEDWARLARRMGPVSEAPLFIDDSPNMSMMEIRAKARRLKQRHDLQLVIIDYMQLMQH
FT                   SSSNSKRPDSRQQEVSEISRSLKLLAKELEVPVIAISQLNRGPEQRTDKRPMMSDLRES
FT                   GSLEQDADVIILLHREDAYERESPRAGEADLIVAKHRNGPTANITVAFQGHYSRFVDMA
FT                   QS"
     atgagcatcg acgacctccc gtacaccgcc gacgaggcct accagggcgg attcgaacgg        60
     accccgcccc aggacatccc ggccgagcag tcggtcctgg gcggcatgct gctgtccaag       120
     gacgcgatcg ccgaggtcat cgaggtcatc aaggccatcg acttctacaa gccggcccac       180
     gaggccgtct tcggcgcgat cctggagctc tacggccgcg gcgagcccgc ggacccggtc       240
     accgtcgcgg cgctgctgac caagaagggt gacatcaacc gcatcggcgg cgcgccctat       300
     ctgcacaccc tgatcaactc ggtccccacc gccgcgaacg ccggctacta cgccgagatc       360
     gtcaaggagc gcgccgtcct gcgccgcctg gtcgaagcgg gcacccgcat cgtccagatg       420
     ggctacagca ccgacggcag cgacgtcgag cagatcgtcg acgccgccca gcaggagatg       480
     tacaacgtca ccgaagcccg caccagcgag gacttcatcc ccctggccga cgccatggaa       540
     ggcgccctgg acgagatcga gtcgatctcc aaccgctccg gccagatgac cggcgtcccc       600
     accggcttcc acgacctcga cgccctgacc aacggcctgc acccgggcca gatggtgatc       660
     atcgcggccc gcccggccat cggcaagagc accctgggac tggacctcgc ccgcagctgc       720
     tccatcaaga acggcctgac cagcgtcatc ttctccctgg agatgggccg caacgagatc       780
     atcatgcgcc tgctctccgc cgaggcccgc gtcgccctgc accacatgcg cagcggcacg       840
     atgaccgacg aggactgggc ccgcctggcc cgccgcatgg gcccggtctc cgaggcgccg       900
     ctgttcatcg acgactcgcc caacatgtcc atgatggaga tccgcgccaa ggcccgccgc       960
     ctgaagcagc gccacgacct ccagctggtg atcatcgact acatgcagct gatgcagcac      1020
     agcagcagca actccaagcg ccccgacagc cgccagcaag aagtctccga gatctcccga      1080
     tccctgaagc tcctggccaa ggaactcgaa gtcccggtca tcgccatcag ccagctgaac      1140
     cgaggcccag aacagcgcac cgacaagcgc cccatgatga gcgacctccg cgaatccggc      1200
     tccctggaac aggacgccga cgtcatcatc ctcctccacc gcgaggacgc ctacgaacgc      1260
     gaatcccccc gcgccggcga agccgacctg atcgtcgcca agcaccgcaa cggcccgacc      1320
     gcgaacatca ccgtcgcctt ccagggccac tactcgcggt tcgtggacat ggcgcagagc      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page