(data stored in ACNUC7421 zone)

EMBL: CP001700.PE331

CP001700.PE331       Location/Qualifiers
FT   CDS_pept        complement(372303..373931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69286"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD0"
FT                   /inference="similar to AA sequence:KEGG:SCO4070"
FT                   /protein_id="ACU69286.1"
FT                   /translation="MHVPSRRQSLLILGGLGLAATAGGAYLLENHGGGSGKPAANPPKP
FT                   QPQPQARGRAKSTYGTGDANEGQEGEPSNATGETVPSLALALADDGAWRPDATGYLAVD
FT                   DEGHQIKGFASATSINVGESIDFHISVRPAQSFTVKVYRIGRSAAGKGSELVFTSAKVT
FT                   GKVQPALKVVAPTRTVVAPWQLSYTLNVPNTWRGGLYVATLETADKYRSCIPFVVREDG
FT                   KPADLLVVLPFTTYQAYNMYPVDKALGASLYNAYQPDGREGGADICATRVSFDRPYHQD
FT                   GLPRLFELDQAFAQWVEAQPYTISYASSIDLHAGRIDPAKYKALVFSGHDEYWTPQMRA
FT                   VLQGALSRGVSAAFMAANNVYWNIRLDASQGGSQYRQVTCYKRRPDPAATGSVAPTVLW
FT                   RDLNQPEQQVLGSMYTAIITDTQPQPLVVGETGHWFWAGTGLKNGEQIPRLVAGEADKV
FT                   FPHVKGGPKTTVLATSPFTAEGPKNTPVKDTQQTVLSQYPSGAWMFNAGTFHWNHGLST
FT                   PGFVDVRIQRATRNLLDRMTGKRSA"
     atgcacgtcc cctcccgccg ccaatcactg ctgattctcg gcggtctcgg gctggcggcc        60
     actgccggcg gcgcttacct gctggagaac cacggcggcg gctccggcaa gccggccgcg       120
     aaccctccca agccccagcc gcagccgcag gcgcgcgggc gtgcgaagag cacctacggc       180
     accggcgacg ccaacgaggg ccaggagggc gagccgagca acgccaccgg cgagaccgtc       240
     ccgagcctcg cgctggccct ggcggacgac ggcgcctggc gcccggacgc caccgggtac       300
     ctggcggtcg acgacgaggg ccaccagatc aagggtttcg cctcggcgac cagcatcaac       360
     gtcggggagt cgatcgactt ccacatcagc gtgcggccgg cgcagagctt cacggtcaag       420
     gtctaccgga tcgggcgcag tgccgccggg aagggctctg agctggtctt caccagtgcc       480
     aaggtcaccg ggaaggttca gccggcgctg aaggtcgtcg cgccgacccg gaccgtcgtg       540
     gcgccgtggc agttgtcgta cacgctgaac gtcccgaaca cctggcgcgg cggtctgtac       600
     gtcgcgacgc tggagaccgc ggacaagtac cgcagctgca tcccgttcgt ggtgcgcgag       660
     gacggcaagc ccgcggatct gttggtggtg ctgcctttca cgacgtatca ggcgtacaac       720
     atgtacccgg tcgacaaggc gctcggcgcc agcctgtaca acgcctacca gcccgacggg       780
     agggagggcg gcgccgacat ctgcgcgacc cgcgtctcct tcgaccggcc gtaccaccag       840
     gacgggctgc cgcggctgtt cgagctcgac caggccttcg cgcagtgggt cgaggcgcag       900
     ccgtacacca tctcctacgc ctcgagcatc gacctgcacg ccggccggat cgacccggcg       960
     aagtacaagg cgctggtctt ctcaggccac gacgaatact ggacgccgca gatgcgcgcc      1020
     gtgctccaag gcgcgctttc taggggtgtc agtgccgcgt tcatggccgc gaacaacgtc      1080
     tactggaaca tccgcctgga cgcctcccag ggcggctccc agtaccggca ggtgacctgc      1140
     tacaagcggc gtccggaccc ggcggcgacc gggagcgtgg cgcccacggt gctgtggcgg      1200
     gacctgaacc agcccgagca gcaggtgctg gggtcgatgt acaccgcgat catcaccgac      1260
     acccagccgc agccgctggt ggtcggcgag accgggcact ggttctgggc ggggaccggg      1320
     ctgaagaacg gggagcagat cccgcgtctg gtggccggcg aggcggacaa ggtgttcccg      1380
     catgtgaagg gcgggccgaa gaccacggtc ctggcgacgt cgccgttcac cgccgagggt      1440
     ccgaagaaca cgccggtcaa ggacacgcag cagaccgtgc tgagccagta cccctccggg      1500
     gcgtggatgt tcaacgccgg gacgttccac tggaaccacg ggctgtcgac gccggggttc      1560
     gtcgacgtgc ggatccagcg ggccacgcgg aacctgctgg atcggatgac cgggaagcgc      1620
     tcggcctag                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page