(data stored in ACNUC7421 zone)

EMBL: CP001700.PE332

CP001700.PE332       Location/Qualifiers
FT   CDS_pept        complement(374094..374549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0334"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: sma:SAV_4286 50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69287"
FT                   /db_xref="GOA:C7PVD1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD1"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ACU69287.1"
FT                   /translation="MATTKLILTHEVGGLGEPGDVVEVKGGYARNYLVPRGYAIAWTRG
FT                   GEKQIELIRKARKVRTVRDLAHATELKGELEGLRVRLATRAGESGRLFGGVTVADVADA
FT                   VKRAGGPDVDKRRIEIGNPIKTVGAHTVSVRLHPEVQAKVEITVVAA"
     atggctacca cgaagctcat cctcacccac gaggtcggcg ggctcggcga gcccggcgac        60
     gtcgtcgagg tcaagggcgg ctacgcccgc aactacctcg tcccgcgcgg ctacgccatc       120
     gcgtggaccc gcggcggcga gaagcagatc gagctgatcc gcaaggcccg caaggtccgc       180
     acggtccgcg acctggccca cgccaccgag ctcaagggcg agctggaggg cctgcgggtc       240
     cgcctggcga cccgggccgg ggagtccggc cggctgttcg gcggcgtgac cgtcgccgac       300
     gtcgccgacg cggtcaagcg cgccggcggc ccggacgtgg acaagcgccg gatcgagatc       360
     gggaacccga tcaagaccgt cggcgcccac accgtctcgg tccggctgca ccccgaggtg       420
     caggcgaagg tggaaatcac cgtcgtcgcg gcctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page