(data stored in ACNUC7421 zone)

EMBL: CP001700.PE333

CP001700.PE333       Location/Qualifiers
FT   CDS_pept        complement(374568..374804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0335"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: sma:SAV_4287 30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69288"
FT                   /db_xref="GOA:C7PVD2"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD2"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ACU69288.1"
FT                   /translation="MPKAPLRKPKKKVCGFCKDKVAYVDYKDTTLLRKFISDRGKIRAR
FT                   RVTGNCTQHQRDVAVAVKNSREMALLPYTSTTR"
     atgcctaagg cacctctccg caagcccaag aagaaggttt gcggattctg caaggacaag        60
     gtcgcgtacg tcgactacaa ggacaccacg ctgctccgga agttcatctc ggaccgcggg       120
     aagatccgtg ctcgtcgcgt gaccggcaac tgcacccagc accagcgcga cgtcgccgtg       180
     gccgtgaaga acagccgtga gatggcgctg ctgccctaca ccagcaccac ccgctag          237
//

If you have problems or comments...

PBIL Back to PBIL home page