(data stored in ACNUC7421 zone)

EMBL: CP001700.PE334

CP001700.PE334       Location/Qualifiers
FT   CDS_pept        complement(374899..375558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0336"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: sgr:SGR_3673 putative single-strand DNA-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69289"
FT                   /db_xref="GOA:C7PVD3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD3"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACU69289.1"
FT                   /translation="MAGETVITVVGNLTDDPELRFTPSGAAVANFTVASTPRTLDRQTN
FT                   EWKDGDALFLRCSIWRQAAENVAESLTRGMRVIVSGRLRQRSYETKEGEKRTVVELDVE
FT                   EIGPSLKYATAKVTKANRPGGQGGPGGGGGGGWSGNSGGGGNSGSAGGGGGWGGNSGGG
FT                   GNSGGGGGGGGSWGGNSGGGGGNSGGGNQGGGNDPWASGGGGDGGWGGYGNDEPPF"
     atggcaggcg agaccgtcat caccgtcgtc ggcaacctga ccgacgaccc cgaactgcgc        60
     ttcaccccct cgggtgcggc ggtcgcgaac ttcaccgtcg cgtccacgcc gcgcaccctg       120
     gaccgccaga ccaacgagtg gaaggacggc gacgcgctgt tcctgcgctg ctcgatctgg       180
     cgccaggcgg ccgagaacgt cgccgaatcg ctgacccgcg gcatgcgggt gatcgtctcc       240
     ggacggctgc gccagcggtc gtacgagacc aaggaaggcg agaagcgcac ggtcgtcgag       300
     ctcgacgtcg aggagatcgg cccgtcgctg aagtacgcga cggcgaaggt caccaaggcc       360
     aaccggcccg gtggccaggg cggtcccggc ggcgggggcg gcggcggctg gagtggcaac       420
     tccggcggcg gcggcaactc cggcagcgcg ggaggcggcg gcggctgggg tggcaactcc       480
     ggtggcggcg gcaactccgg cggtggcggt ggcggcggcg gcagttgggg tggcaactcc       540
     ggtggcggcg gtggcaactc cggcggcggg aaccagggcg gcggcaacga cccctgggct       600
     tccggcggcg gcggcgacgg cggctggggt ggctacggca acgacgagcc cccgttctag       660
//

If you have problems or comments...

PBIL Back to PBIL home page