(data stored in ACNUC7421 zone)

EMBL: CP001700.PE335

CP001700.PE335       Location/Qualifiers
FT   CDS_pept        complement(375589..375894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0337"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: sco:SCO3906 30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69290"
FT                   /db_xref="GOA:C7PVD4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD4"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACU69290.1"
FT                   /translation="MRQYEVMVILDPDLDERSIAPALEGFLKVIRDLGGSIEKNDIWGR
FT                   RRLAYEIKTKSGKKVSEGIYAVVDVQATPDAVKEFDRQANLSETVVRTKVIRPDQR"
     atgcgtcagt acgaagtcat ggtcatcctg gacccggacc tcgacgagcg ttcgatcgcc        60
     ccggccctcg agggattcct caaggtgatc cgcgatctgg gcggctccat cgagaagaac       120
     gacatctggg gacgccgtcg gctcgcctac gagatcaaga ccaagagcgg caagaaggtc       180
     agcgagggca tctacgccgt cgtcgacgtg caggccacgc cggacgccgt caaggagttc       240
     gaccgtcagg cgaacctgtc cgagaccgtc gtccgcacca aggtcatccg tcccgaccag       300
     cggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page