(data stored in ACNUC7421 zone)

EMBL: CP001700.PE336

CP001700.PE336       Location/Qualifiers
FT   CDS_pept        376147..376506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69291"
FT                   /db_xref="GOA:C7PVD5"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD5"
FT                   /inference="similar to AA sequence:KEGG:SAV_4290"
FT                   /protein_id="ACU69291.1"
FT                   /translation="MTQTTPGTGDYGPEVAGRPGSTAADYAEDPKERPGFHIGSHTQEM
FT                   ALTITALVLAVVAAAMIGWTGGHVLGGWIALAGIVVGLYAQLTSDTTYERMVNVCAIGI
FT                   AAVAFAFHLHHGGLW"
     atgacgcaga cgacccccgg cacgggcgac tacggcccgg aggtggccgg acgacccgga        60
     tccacggccg cggactacgc ggaggatcca aaggagcggc cgggcttcca tatcggcagc       120
     cacacccagg agatggcgct gacgatcacc gccttggtgc tggccgtcgt cgccgcggcg       180
     atgatcggct ggaccggcgg gcacgtcctg ggcggctgga tcgcgctggc cgggatcgtg       240
     gtcggtctct acgcgcagct gacctcggac accacctacg agcgcatggt gaacgtgtgt       300
     gccatcggga tcgcggcggt ggccttcgcc ttccacctgc atcacggtgg tctctggtag       360
//

If you have problems or comments...

PBIL Back to PBIL home page