(data stored in ACNUC7421 zone)

EMBL: CP001700.PE337

CP001700.PE337       Location/Qualifiers
FT   CDS_pept        376634..377422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0339"
FT                   /product="apurinic endonuclease Apn1"
FT                   /note="KEGG: nca:Noca_4666 endonuclease IV; TIGRFAM:
FT                   apurinic endonuclease Apn1; PFAM: Xylose isomerase domain
FT                   protein TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69292"
FT                   /db_xref="GOA:C7PVD6"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD6"
FT                   /inference="protein motif:TFAM:TIGR00587"
FT                   /protein_id="ACU69292.1"
FT                   /translation="MAMRIGSHVGNEDPIAEAVARGADAVQIFLGDPQSWKAPTVAYPG
FT                   GASALRAAAEQADVAVYVHAAYIINVAATNNRIRIPSRKLLQQTVALAAEAGARGVVVH
FT                   GGHSTAADAPDAGFDNWRKAVDQLEQHCPVFIENTAGGDHAMARRIDAIAKLWDAVGHS
FT                   GIGLCLDTCHAFAGGIPLESAVADIKAVTGRVDLVHANDSQGGFDSGIDRHANFGSGEI
FT                   APADLIAQVIAEAGCPAICETPGGAEAQAADIKWLRERVA"
     atggctatgc gtatcggctc ccacgtcggc aacgaagacc cgatcgcgga ggcggtggcc        60
     cgtggcgccg acgccgtcca gatcttcctg ggcgatccgc agagctggaa ggcgccgacc       120
     gtcgcttatc cgggcggcgc ctccgcgctg cgcgctgccg ccgagcaggc cgacgtcgcc       180
     gtctacgtgc acgccgcgta catcatcaac gtcgcggcca ccaacaaccg gatccgcatc       240
     cccagccgca agctgctgca gcagacggtc gcgctggccg ccgaggcagg cgcgcgcggc       300
     gtcgtcgtgc acggcggcca cagcaccgcc gccgacgcac cggatgccgg cttcgacaac       360
     tggcgcaagg ccgtggacca gttggagcag cactgcccgg tcttcatcga gaacaccgcc       420
     ggcggcgacc acgccatggc gcggcggatc gatgcgatcg cgaagctgtg ggacgccgtg       480
     gggcacagcg ggatcggact gtgcctggac acctgccacg ccttcgccgg cggcatcccg       540
     ctggagagcg ccgtggccga catcaaggcc gtcaccggcc gcgtcgacct ggtccacgcc       600
     aacgactcgc agggcggctt cgactccggc atcgaccggc acgccaactt cggcagcggc       660
     gagatcgccc cggccgacct gatcgcgcag gtgatcgccg aggccggctg cccggcgatc       720
     tgcgagaccc ccggcggtgc cgaggcgcag gcggcggaca tcaagtggct gcgggagcgc       780
     gtcgcataa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page