(data stored in ACNUC7421 zone)

EMBL: CP001700.PE338

CP001700.PE338       Location/Qualifiers
FT   CDS_pept        377432..378616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0340"
FT                   /product="Methicillin resistance protein"
FT                   /note="PFAM: Methicillin resistance protein; KEGG:
FT                   sma:SAV_4291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69293"
FT                   /db_xref="GOA:C7PVD7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD7"
FT                   /inference="protein motif:PFAM:PF02388"
FT                   /protein_id="ACU69293.1"
FT                   /translation="MVLRVRTLSREEHVAFIEERTAEKNAATSVSFLQCPSWGDLKTDW
FT                   RAESVGWVEDASGEVVGAALVLYRDVPIPKRDKLPFLRRSLAYLPEGPILDLTSADAGQ
FT                   ALKLLVAHLRKRRAFTVKMGPQMVSRRWTSETLKKAIAETEGGVRLKDIKPDFEDPTAL
FT                   SIIEKLRATGWSRKESEGAGFGDFQPRYVFQLPLVDESGKPRTLEDIQKGFNQLWRRNI
FT                   KKADKNGVEVTLGGYDDLAEFHKIYEVTAVRDHFTPRPLAYFQRMWKAMEAENPNRLRL
FT                   YLARHEGELLAATTLVTVGDHAWYSYGASADHKRELRPSNAIQWRMLSDSHASGCKVYD
FT                   LRGISDTLDPNDHLFGLIQFKLGTGGQAVEYLGEWDYALNPVLHRAFEMYMARR"
     atggtcttga gggtgcggac gctgagccgc gaggaacatg tggcgttcat cgaggagcgc        60
     acggctgaga agaacgccgc gacctctgtc agctttctgc agtgcccttc ctggggggat       120
     ctgaagaccg attggcgcgc cgagtcggtc ggctgggtcg aagacgccag cggcgaggtc       180
     gtcggtgcgg ccctggtcct gtaccgggac gtgccgatcc ccaagcggga caagctcccg       240
     ttcctgcggc ggtcgctggc atacctgccc gagggcccga tcctggacct gacgtccgcg       300
     gacgccgggc aggcgctgaa gctgctggtg gcgcacctgc ggaagcggcg cgcgttcacg       360
     gtgaagatgg gtccgcagat ggtgtcgcgg cggtggacgt ccgagacgct gaagaaggcc       420
     atcgccgaga ccgagggcgg cgtccggctc aaggacatca agccggactt cgaggacccc       480
     accgcgctga gcatcatcga gaagttgcgc gccaccggat ggtcccggaa ggagtccgag       540
     ggcgccgggt tcggcgactt ccagccccgg tacgtcttcc agctgccgct ggtcgacgag       600
     tccgggaagc cgcgcaccct ggaggacatc cagaagggct tcaaccagct ctggcgccgg       660
     aacatcaaga aggcggacaa gaacggcgtc gaggtcaccc tcggcggcta cgacgacctc       720
     gcggagttcc acaagatcta cgaggtgacc gcggtccgcg accacttcac gccgcggccg       780
     ctggcgtact tccagcggat gtggaaggcg atggaggccg agaaccccaa ccggctgcgc       840
     ctctatctgg cccgccacga gggcgaactg ctggccgcca cgactctggt caccgtcggg       900
     gaccacgctt ggtactcgta tggcgcctcc gccgaccaca agcgtgagct gcgtccgtcc       960
     aacgcgatcc agtggcggat gctcagcgat tcgcacgcgt ccggctgcaa ggtgtacgac      1020
     ctgcgcggca tcagtgacac gctggacccg aacgaccacc tgttcggact catccagttc      1080
     aagctgggga ccggcggtca ggcggtggag tatctcgggg agtgggacta cgcactgaat      1140
     ccggtactgc accgcgcatt cgagatgtac atggcccgcc gctaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page