(data stored in ACNUC7421 zone)

EMBL: CP001700.PE339

CP001700.PE339       Location/Qualifiers
FT   CDS_pept        378675..379733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0341"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   sco:SCO3903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69294"
FT                   /db_xref="GOA:C7PVD8"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD8"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACU69294.1"
FT                   /translation="MSLTLHIDAERWRAHQDEVLARHPDLVPVAKGVNGYGIGIPNLMQ
FT                   AASKLAAAGVEITAVGTAAEAEQAKDHYSGRLLVLTPYLIGEDVRDLPDRVIRTVASVE
FT                   AVEALLGRRVVIDLMTSMRRFGLEKQDIPRLHAALESDQARVEGFSVHMPLDRVAGDYL
FT                   REVSDWVDALVAAGIPVRTLFVSHLSPDEISTLAKRHQGTTVRPRIGTQLWLGDRKALQ
FT                   ARGTVHSVQKVSKGDRFGYRQHKARGDGHLLVVSGGTAHGVGLENPKNFGRGPAGLTPR
FT                   AKFAARAAMALLNRTMSPYSWQGKTLWFAEPPHMQVSVLFLPAGVAPPKVGEEIPVEVS
FT                   PVMTHVDRVVFD"
     ttgtcgctga cgctgcacat cgacgcggag cgctggcgcg cccaccagga cgaggtgctg        60
     gcccgccatc ctgatctggt gccggtggcc aagggcgtca acggctatgg gatcgggatt       120
     ccgaacctca tgcaggcggc ttctaagctg gctgcggcgg gcgtggagat aacggcagtg       180
     ggcacggcgg ccgaggcgga gcaggcgaag gaccactatt cagggcgcct gttggtcctc       240
     actccgtact tgatagggga ggacgtccgc gatctgccgg accgcgtgat ccgcacggtg       300
     gcgtcggtgg aggcggtcga agcccttttg gggcggcgcg tggtcatcga cctgatgacg       360
     tccatgcgcc gcttcggcct ggagaagcag gacatcccga gactgcacgc cgcactcgaa       420
     tccgaccagg cgcgcgtcga gggcttctcg gtccacatgc ccctggaccg cgtcgccggc       480
     gactacctcc gcgaagtcag cgactgggtg gacgccctgg tcgccgcggg catcccggtc       540
     cgaaccctgt tcgtcagcca cctgtcgccc gacgaaatca gcaccctggc caagcgccat       600
     cagggcacga cggtacgccc gcgcatcggc actcagctct ggctcggcga ccgcaaggcg       660
     ctccaggcac gcggaaccgt ccacagcgtc cagaaggtca gcaagggcga ccgcttcggc       720
     taccgccaac acaaggcgcg cggcgacggc cacctcctcg tcgtctccgg cggcaccgcc       780
     cacggcgtcg gactggagaa ccccaagaac ttcggccgcg gcccagcagg cctcacgccc       840
     cgcgcgaagt tcgcagcccg agccgccatg gcactcctga accgcaccat gtccccttac       900
     tcctggcagg gcaagacact ctggttcgcc gagccgccgc acatgcaagt gtcggtactg       960
     ttcctgcccg cgggcgtcgc gccgcccaag gtgggggagg agatcccggt cgaggtgagc      1020
     ccggtgatga cgcacgtgga ccgggtggtc ttcgactga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page