(data stored in ACNUC7421 zone)

EMBL: CP001700.PE34

CP001700.PE34        Location/Qualifiers
FT   CDS_pept        34163..34690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0034"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: sgr:SGR_3729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68989"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ0"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU68989.1"
FT                   /translation="MSQLTLTVIRLAFLVLLWLFVFSAVGVMRSDLYGSRTSKRQQAKA
FT                   AKAAAAATQQVPARGGARQQPYNPGARRSGPPAPTRLVVVGGSLAGTTVNITSGQQVTM
FT                   GRAHDSTIVLDDDYASSRHARLYPDASGQWIVEDLGSTNGTFLGQTKLNAPTVAQIGVP
FT                   IRIGKTVLELRA"
     atgtcccagc tgaccctcac ggtgatccgg ctcgccttcc tggtgctgct gtggctgttc        60
     gtgttctccg cggtcggggt catgcgctcc gacctctacg gatcccggac gagcaagcgc       120
     cagcaggcca aggcagccaa ggccgccgcc gcggcgaccc agcaggtgcc cgcgcgcggc       180
     ggcgcccgcc agcagcccta caaccccggt gcccgccgca gcggcccgcc ggcgcccacc       240
     cggctggtgg tggtcggcgg ctcgctggcc ggcaccaccg tcaacatcac cagcggccag       300
     caggtgacga tgggccgggc acacgactcg accatcgtgc tggacgacga ctacgcctcc       360
     agccggcacg cgcggctcta tccggatgcc tccgggcagt ggatagtcga agacctcggc       420
     tccaccaacg gcaccttcct cgggcagacg aagctgaacg cgccgaccgt ggcacagatc       480
     ggtgtcccga tccgcatcgg caagaccgtg ctcgagttgc gcgcatag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page