(data stored in ACNUC7421 zone)

EMBL: CP001700.PE340

CP001700.PE340       Location/Qualifiers
FT   CDS_pept        complement(380045..381613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69295"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVD9"
FT                   /inference="similar to AA sequence:KEGG:SAV_4147"
FT                   /protein_id="ACU69295.1"
FT                   /translation="MSSTSKFLRDLAKKTNTASAARAVLRATHLKSGPGRLSDPRVGLP
FT                   ASVLPAGGNRITAENAKAGSADWRMGASKSRPGTDYERQIKGYASTDSVAAGEAIDFHI
FT                   AVEPAGSFTVSVYRLGYYGGASARRVLVSPTLTAAPQPVPTPDQETGRIALEWPVAWTL
FT                   DIPKDWTPGTYVAVLDKADGFRNYVPFVVRDDEASADFLVVLPSTSWQAYNWWPRDGIT
FT                   GRNVYYGYVTKEAAESDAALKAKFSTDARGWISNPARATQVSFARPYFADGLPDGFVRE
FT                   QSFIQWAEGMGYDLSYATGLDLHAGRIDPTKYRGLIFAGHDEYWSTDMYRHAEEAVAAG
FT                   TSLAFLTANNAYWHVRYDEHTRTMSCYKGFEDPHTEDFPTGMWRAGEGNPRAEQQLMGV
FT                   QYSGILKGRHPLIVHEADHWFWSGTGLTNGDEIPGLLGGEADSLFEAMPRAKAEEQALL
FT                   TASPYTISNGTNFTQNTSIYRSPSGAWVFTAGTFLWPLGLGHPTYQDKRITRATANFLS
FT                   RVKGS"
     atgtcgagca cgtcgaagtt cctgcgcgat ctggccaaga agaccaacac ggcttcggcc        60
     gcgcgcgccg tcctgcgggc cacgcatttg aagtccgggc cggggcggct cagtgatccg       120
     cgagtagggc ttccggcatc cgttctcccg gccggtggga accgcattac tgcggagaac       180
     gctaaggcgg gttctgcgga ctggcgcatg ggtgcgagca agtcgcgccc cggtacggac       240
     tacgagcggc agatcaaggg ctacgcgtcg accgattcgg tggcggccgg ggaagctatc       300
     gacttccata tcgcggtgga gcccgcgggg tccttcacgg tttccgtcta ccgcctcggc       360
     tactacggcg gcgcctcggc tcgccgcgtc ctggtgtcgc cgacgctgac cgctgcgccg       420
     cagccggtac cgacgccgga tcaggagact ggccggatcg ccttggaatg gcccgttgca       480
     tggacgctcg acatccctaa ggactggacg ccagggacct acgtagctgt cctcgataag       540
     gccgacgggt tccggaacta cgtgccgttc gtagtgcgtg atgacgaggc gtcggcggac       600
     ttcctcgtgg tgctgccgtc gacgagctgg caggcgtaca actggtggcc gcgtgacggc       660
     atcactgggc ggaacgtcta ctacgggtac gtcaccaagg aagccgccga aagcgacgct       720
     gccctcaagg cgaagttctc cacagacgcg cgcggctgga tctcgaaccc ggcgcgcgca       780
     acgcaggtct ccttcgcgcg cccctacttc gccgacggac tccccgacgg cttcgtccgc       840
     gaacagtcct tcatccagtg ggccgagggc atgggctatg acctcagcta cgcgacaggg       900
     ctggacctcc acgccggacg catcgacccg accaagtacc gcggcctgat cttcgccggc       960
     cacgacgagt actggtcgac cgacatgtac cggcacgccg aagaggcggt cgcagcaggc      1020
     acgtccctag cgttcctcac agcgaacaac gcctactggc acgtccgcta cgacgaacac      1080
     acgcgaacca tgtcctgcta caagggcttc gaagaccccc acaccgaaga ctttcccact      1140
     ggcatgtggc gcgccggcga aggcaacccc cgcgccgaac agcaactcat gggagtgcag      1200
     tacagcggca tcctcaaggg ccgccacccc ctcatcgtcc acgaagccga ccactggttc      1260
     tggagcggca ccggcctcac aaacggcgac gaaatccccg gcctcctcgg cggcgaagcc      1320
     gacagcctct tcgaagcaat gccccgagcc aaggcagagg aacaggcact cctgaccgcc      1380
     tcgccctaca ccatctccaa cggcacaaac ttcacccaga acaccagcat ctaccgatcc      1440
     cccagcggcg cctgggtctt cacagcgggc acattcctct ggcctctagg cctaggccac      1500
     cccacctacc aggacaagcg catcacccgc gccacagcca acttcctgag ccgggtgaag      1560
     ggttcctga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page