(data stored in ACNUC7421 zone)

EMBL: CP001700.PE341

CP001700.PE341       Location/Qualifiers
FT   CDS_pept        complement(381644..382711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69296"
FT                   /db_xref="GOA:C7PVE0"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE0"
FT                   /inference="similar to AA sequence:KEGG:SGR_3221"
FT                   /protein_id="ACU69296.1"
FT                   /translation="MAVLTWISAWVFVAGPTKQGSLLARWDRWDEGIFTSVAQHWYFAA
FT                   GTDPRHVAFFPGFPIAMWLAHLVVWNWIAAGLVVSAAAGAIATMALGRLARDEVDASNA
FT                   DADAGQAAANATLFFVLAPAAVFLAAGYSESLFAAFAFSAWVAARRDRWWLAGLLAAGA
FT                   STVRVNGLFLAAAIALEFILAGRERRQWRQAPLLVIPALPVIAYVVYLHHETGDWLAWQ
FT                   HAQAAGWFRTFQSPESAWNQTWRAAFGGTQAGHTAWVFQLELIAVVIGLALTALLLLKR
FT                   RWPEALYVALSLLALGTTTWFMSVPRAMLLWWPLWTMLGAWAARRPMVRTLYVCCVAPV
FT                   MVGVALLFLSGQWAG"
     atggcggtgc tgacgtggat cagcgcgtgg gttttcgtgg cgggaccgac gaaacagggc        60
     tcgttgttag ctcggtggga ccgctgggac gagggcatct tcaccagcgt cgcgcagcat       120
     tggtacttcg ctgcgggcac cgatccgcgg catgtggcgt tctttcctgg gttcccgatc       180
     gctatgtggt tggcgcacct ggtcgtctgg aactggatcg ctgccggatt ggtggtctcg       240
     gcggcggcgg gggcgatcgc gacgatggct ttggggcgtt tggcgaggga cgaggtcgac       300
     gcgtccaacg ctgacgctga cgccggccaa gctgccgcga acgccacgct gttctttgtt       360
     ctcgcaccgg cggcggtgtt tctggctgcg ggctatagcg agagcttgtt cgcggcgttc       420
     gccttttccg cgtgggtagc ggcacggcgg gatcggtggt ggcttgcggg gctccttgcg       480
     gcgggcgcga gcacggtgcg cgtgaacggg ctgttccttg cggcagccat cgccttggag       540
     ttcatacttg ccggacggga gcggcggcag tggcgccagg cgccgctgct tgtcatacct       600
     gccctgccgg tcatcgccta tgtcgtgtac ctgcaccacg agaccgggga ctggcttgcg       660
     tggcagcatg cgcaggccgc tggttggttc cgtacgttcc agagcccgga atccgcctgg       720
     aaccagacgt ggcgggctgc ctttggcggt acgcaggcgg gccacactgc gtgggtcttt       780
     cagctggaac tgatcgctgt ggtcatcggg ctcgcgctca ctgcgcttct cctccttaag       840
     cgccgctggc cagaggctct atatgtggct ctctctttgt tggctctagg gaccactacc       900
     tggttcatgt ccgtccctcg cgcgatgctc ctgtggtggc cgctgtggac gatgctcggc       960
     gcgtgggcag ctcggcggcc gatggtgcgg acgctctacg tgtgctgcgt cgccccggtc      1020
     atggtggggg tggcgttgtt gttcctgtcg ggtcagtggg cgggctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page