(data stored in ACNUC7421 zone)

EMBL: CP001700.PE342

CP001700.PE342       Location/Qualifiers
FT   CDS_pept        complement(382884..384455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0344"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3902 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69297"
FT                   /db_xref="GOA:C7PVE1"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE1"
FT                   /inference="similar to AA sequence:KEGG:SCO3902"
FT                   /protein_id="ACU69297.1"
FT                   /translation="MQTGDGAVGHDVQVSSDVSDQAPGPSAEPTGRGAATAPVIVAPSL
FT                   DDPVVNAASDAVGGPLGVRAWRPRLGSGAAIRTVARVLVLLTLLTLGIGVAQRSPCYST
FT                   AWNGTGKQQYNHLCYTDVPYMYYGRGFDKSLTPYRQSDPASGNYGLEYPVVAGATMETA
FT                   ALLAQKLGADTPDQVRWFYNVTTWFLIVFALVCVLAVIGLAGRRPWDAAMFALAPGLLL
FT                   TGTINWDLIAVALASVGMLAWARNKPVVAGIALGLGSATKLYPVFLLIPLLVLCWRAGR
FT                   MRQWSQATGTAVVTWLVVNAPVMILAFKGWKYFFTFNDNRPIDLGSPWFAIRHWWGWEP
FT                   PNKNVVIIALVLAGWLGVALLGLMARRRPRFAQLAFLTVAVFILLNKVYSPQYVLWLIP
FT                   LAALARPRWRDFLIWQICEAAYYVAVWYYLVWQAGPSNGNTRGLPDNFYVWAIVIHLAG
FT                   IVYMMVQIIRDILDPRRDPVRADGIDDDPAGGALSDSPDVWAWSQPRSHRAGHGAGAEP
FT                   ELVASV"
     atgcagacgg gggacggagc ggtagggcac gatgtgcaag tgagttcgga cgtgagcgac        60
     caggcgcccg gcccgtcggc ggaaccgacg ggccggggcg cggcgacggc accggtcatc       120
     gtcgccccct ccctcgacga cccggtggtc aacgccgcct cggacgccgt gggcggtccg       180
     ctcggagtgc gcgcctggcg gcccaggctg ggctccggcg ccgcgatccg caccgtcgcc       240
     agggttctgg tcctgctcac gctgctcacc ctcggcatcg gcgtggcgca gcgctcgccg       300
     tgctactcca cggcgtggaa cggcacgggc aagcagcagt acaaccacct gtgctacacc       360
     gacgtgccgt acatgtacta cggccgcggc ttcgacaaga gcctgacgcc ctaccggcag       420
     tccgacccgg ccagcggcaa ctacggcctg gagtacccgg tcgtggccgg cgcgacgatg       480
     gagaccgcgg cgctgctggc gcagaagctc ggcgccgaca ccccggacca ggtgcgctgg       540
     ttctacaacg tcacgacctg gttcctcatc gtcttcgcgc tcgtctgcgt cctggcggtg       600
     atcgggctcg cgggacgaag accatgggac gcggcgatgt tcgccctcgc cccagggctg       660
     cttctaaccg gaaccataaa ctgggacctc atcgcggtgg ccctggcctc ggtcggcatg       720
     ctcgcctggg cccgcaacaa accggtggtc gccggcatcg ccctgggcct gggctcggcc       780
     acgaagctgt acccggtctt cctgctgatc ccgttgctgg tgctgtgctg gcgcgccggc       840
     cggatgcggc agtggtcgca ggccaccggc acggcggtgg tgacctggct ggtggtgaac       900
     gccccggtca tgatcctggc cttcaagggc tggaagtact tcttcacctt caacgacaac       960
     cgcccgatcg acctgggctc gccgtggttc gcgatccggc actggtgggg ctgggaaccg      1020
     ccgaacaaga acgtggtgat catcgcgctg gtcctggccg gctggctcgg cgtggcgctg      1080
     ctcgggctga tggcccgccg ccgtccgcgc ttcgcccagc tggcgttcct gaccgtcgcg      1140
     gtgttcatcc tgctgaacaa ggtctactcc ccgcagtacg tcctgtggct gatcccgctc      1200
     gcggcgctgg cccgaccgcg ctggcgcgac ttcctgatct ggcagatctg cgaggccgcc      1260
     tactacgtcg cggtctggta ctacctggtc tggcaggccg gacccagcaa cggcaacacc      1320
     cgcggcctcc cggacaactt ctacgtctgg gcgatcgtga tccacctcgc cggcatcgtc      1380
     tacatgatgg tgcagatcat ccgcgacatc ctcgacccgc gccgcgaccc ggtccgcgcc      1440
     gacggcatcg acgacgaccc ggccggcggc gcgctgtcgg acagcccgga cgtgtgggcg      1500
     tggtcgcagc cgcgctcgca ccgcgccgga cacggagccg gcgccgaacc cgaactcgtc      1560
     gcctcggtct ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page