(data stored in ACNUC7421 zone)

EMBL: CP001700.PE343

CP001700.PE343       Location/Qualifiers
FT   CDS_pept        complement(384476..387439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0345"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; KEGG: sma:SAV_4294
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69298"
FT                   /db_xref="GOA:C7PVE2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE2"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACU69298.1"
FT                   /translation="MSEHGSRRGGGGGGGSRGRRSAGGGGFSDKLDGLAHQLSGMFGKR
FT                   GAGRRGDDGYDEYGSYDDRGYGEEPYDDGYGAEPADVAVGGRRGLGRRTAAGSGGAGRG
FT                   GRPGGSGRKDGLPPKDWWMKFINYPRYGKRGWRHWMPSIKQVLSIFLGFLFVVIGGVAY
FT                   VYASTQIPQVKNSIAAGNPTYYTYDDGKEQFANIGVNYYQVNDINTIPKVFQNAFVAAE
FT                   NYSFWSDPGVSFTGVARSALNDLFGSGGTQGGSTITQQYVKNAYLSQDQTLGRKVNEIM
FT                   ISIKLNHTESKQQILLGYLNQISFGRGAYGIDAASRAYFGHPINQMTDANVGEAAFLAA
FT                   LVNDPSNFSTALANGKARTDNPKTFDRFEKRYNAILANMSQYGFVPKTTTAPLENKLPN
FT                   VIDFKGPNLGQYVGYMKDAATAFLAAQMQEYPSDPTTQKYANIDNLSKGGYKIVTTYNH
FT                   VMMNDSVTAANALWTGTSGGGGGKLNPKHASDHDIHLAFASVDPHTGELKSFYTGTDGK
FT                   EDYGSNAFNYALQGGVQVGSTFKPITLATALQSGKFSLDSQEPGTNEKPLFLPGSKQPI
FT                   TFYDTSLHKTAFWPPNEDEEAPPNGGSTTLKQGLAMSLNSVFAALELDPAVGMDAVYNM
FT                   AEQLGIKPGTPDFLKVASLTLGTAEITPMRMANVYGAFANGGVSHEPVQVTAIIDQRTG
FT                   QTVWTPPALRSNSGVNKQVMSVNTAAGVTNALQSVLQKGGTANANHDAAALAAEANYNL
FT                   AGKTGTTDSNHSAWFTGFSTSLATSVAIFRSTADGTLESIKGLGYNDQSTRINGMDWPT
FT                   TVWSAFMKIELDKNKSGFAKPFPPYAPTCSGVSDIPSFPNQSVAPGTLASGSLPGTPTG
FT                   SEANCQSVFVPTPTPTPTPTPTKPTTSTQAPLCTLPMVFDPASQQCVVVPPTSTDTSTQ
FT                   QQPTGTGTSNPTGPGQPTTSPTTPSSRCSRNPQQPGCQTTSPTTSSTSSLSGFPPAG"
     atgagcgagc acggcagtcg gcgcggcgga ggtggcggcg gcggatcacg gggacgccgg        60
     tcggccggcg gcggcggctt ctccgacaag ctcgacgggc tcgcccacca actctcgggg       120
     atgttcggca agcgcggcgc gggccgccgc ggcgacgacg gctacgacga gtacgggtcc       180
     tacgacgacc gcggctacgg cgaggagccc tacgacgacg gctacggcgc cgagccggcc       240
     gacgtcgccg tcggcggacg gcgcgggctg ggacggcgca ccgcggccgg ctccggcggc       300
     gcgggccgcg gcggacgccc gggcggctcc ggccgcaagg acgggctgcc gcccaaagac       360
     tggtggatga agttcatcaa ctacccgcgc tacggcaagc gcgggtggcg gcactggatg       420
     ccctccatca agcaggtcct gtcgattttc ctgggcttcc ttttcgtggt cataggcggc       480
     gtggcgtacg tctacgccag cacgcagatc ccgcaggtca agaacagcat cgcggccggc       540
     aacccgacgt actacaccta tgacgacggc aaagagcagt tcgccaacat cggcgtgaac       600
     tactaccagg tcaacgacat aaacacgatc ccgaaggtgt tccagaacgc gttcgtggcg       660
     gcggagaact actccttctg gtccgacccc ggcgtgtcgt tcaccggtgt ggcccgctcg       720
     gcgctcaacg acctgttcgg cagcggcggc acgcagggcg gctcgacgat cacccagcag       780
     tacgtgaaga acgcgtacct gtcgcaggac cagacgctgg gccgcaaggt caacgagatc       840
     atgatctcca taaagctcaa ccacacggag agcaagcagc agatcctgct cggctacctg       900
     aaccagatct cgttcgggcg cggcgcctac ggcatcgacg cggcctcccg ggcctacttc       960
     ggccacccga tcaaccagat gaccgacgcc aacgtcggcg aggccgcgtt cctggccgcg      1020
     ctggtcaacg accccagcaa cttctccacc gcgctggcca acggcaaggc gcgcaccgac      1080
     aaccccaaga cgttcgaccg tttcgagaag cggtacaacg cgatcctggc gaacatgtcg      1140
     cagtacggat tcgtgccgaa gacgacgacc gcgccgctgg agaacaagct gccgaacgtc      1200
     atcgacttca agggtccgaa cctgggccag tacgtcgggt acatgaagga cgccgcgacg      1260
     gcgttcctcg ccgcgcagat gcaggagtac cccagcgacc cgacgacgca gaagtacgcg      1320
     aacatcgaca acctgtccaa gggcgggtac aagatcgtca ccacgtacaa ccatgtgatg      1380
     atgaacgact cggtcaccgc ggcgaacgcg ctgtggaccg ggaccagcgg tggcggcggc      1440
     gggaagctga acccgaaaca cgcctccgac cacgacatcc atctggcgtt cgcgtctgtg      1500
     gatccgcaca ccggcgagct gaagtcgttc tacaccggta ccgacggtaa agaggactac      1560
     ggctccaacg cgttcaacta cgcgctgcaa ggcggcgtgc aggtcggctc gacgttcaag      1620
     ccgatcacgc tggcgaccgc gctgcagtcc ggcaagttct cgctggacag ccaggaaccg      1680
     ggcaccaacg agaagccgct gttcctgccg ggctcgaagc agccgatcac cttctacgac      1740
     acctccttgc acaagaccgc gttctggccg cccaacgagg acgaggaagc cccgccgaac      1800
     ggcggcagca ccaccctgaa gcagggcctt gcgatgtcgc tgaactctgt gttcgcggcg      1860
     ctggagctgg acccggcggt cgggatggac gcggtctaca acatggccga gcagctcggc      1920
     atcaagcccg gcacccccga cttcctgaag gtcgcctcgc tgaccctggg caccgccgag      1980
     atcacgccga tgcgcatggc caacgtctac ggcgccttcg ccaacggcgg cgtgtcgcac      2040
     gagccggtgc aggtcaccgc gatcatcgac cagcgcaccg ggcagaccgt ctggactccc      2100
     ccggccctgc ggtcgaacag cggggtcaac aagcaggtga tgtccgtgaa caccgccgcc      2160
     ggcgtcacca acgcgctgca gtcggtcctt cagaagggcg gcacggccaa cgcgaaccac      2220
     gacgcggccg ccctggccgc cgaggcgaac tacaacctgg ccggcaagac cggtaccacc      2280
     gacagcaacc actcggcctg gttcaccggc ttctccacct ccctggcgac ctcggtggcg      2340
     atcttcagat ccacggcgga cggaaccctg gagtcgatca agggtctggg ctacaacgat      2400
     caatcgaccc gcatcaacgg tatggactgg cccacgacgg tctggtcggc gttcatgaag      2460
     atcgaactgg acaagaacaa gagcggcttc gccaaaccgt tcccgccgta cgcgccgacc      2520
     tgttccggtg tcagcgacat cccgagcttc cccaaccagt cggtcgcgcc cggcacgctg      2580
     gcctccggct cgctccccgg cacgccgacc ggctcggagg cgaactgcca gtcggtgttc      2640
     gtcccgacgc cgaccccgac gccgacgccc accccgacga agccgacgac atccacgcag      2700
     gcgccgctgt gcaccctgcc gatggtgttc gacccggcgt cgcagcagtg tgtggtggtg      2760
     cccccgacct cgacggacac cagtacgcag cagcagccga ccggcaccgg cacgtcgaac      2820
     cccaccggtc cgggccagcc gaccaccagc ccgaccacgc cgtcgagcag gtgcagcagg      2880
     aacccgcaac aacccgggtg tcagacgacg tcgccgacga cgtccagcac ctcgagcctg      2940
     agcggtttcc cgcccgcggg ctga                                             2964
//

If you have problems or comments...

PBIL Back to PBIL home page